BLASTX nr result
ID: Achyranthes22_contig00057851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057851 (646 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006415981.1| hypothetical protein EUTSA_v10008695mg [Eutr... 57 5e-06 ref|XP_006304180.1| hypothetical protein CARUB_v10010228mg [Caps... 57 5e-06 >ref|XP_006415981.1| hypothetical protein EUTSA_v10008695mg [Eutrema salsugineum] gi|557093752|gb|ESQ34334.1| hypothetical protein EUTSA_v10008695mg [Eutrema salsugineum] Length = 226 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 611 QYAVFGKVTKGDETFRKLEDVPTQKVGIFVM 519 QYAVFGKVTKGDET RKLE+VPT++ GIFVM Sbjct: 149 QYAVFGKVTKGDETLRKLEEVPTRREGIFVM 179 >ref|XP_006304180.1| hypothetical protein CARUB_v10010228mg [Capsella rubella] gi|482572891|gb|EOA37078.1| hypothetical protein CARUB_v10010228mg [Capsella rubella] Length = 226 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 611 QYAVFGKVTKGDETFRKLEDVPTQKVGIFVM 519 QYAVFGKVTKGDET RKLE+VPT++ GIFVM Sbjct: 149 QYAVFGKVTKGDETLRKLEEVPTRREGIFVM 179