BLASTX nr result
ID: Achyranthes22_contig00057783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057783 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding ... 64 2e-08 ref|NP_001235369.1| guanine nucleotide-binding protein subunit b... 64 2e-08 gb|AFK36580.1| unknown [Medicago truncatula] 64 2e-08 ref|XP_003631071.1| Guanine nucleotide-binding protein subunit b... 64 2e-08 ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycin... 64 2e-08 gb|ACJ85349.1| unknown [Medicago truncatula] 64 2e-08 gb|ACJ85009.1| unknown [Medicago truncatula] 64 2e-08 gb|AGV54321.1| RACK1 [Phaseolus vulgaris] 64 2e-08 gb|ACV72060.1| RACK1 [Phaseolus vulgaris] gi|561033921|gb|ESW325... 64 2e-08 gb|ACJ24167.1| Rack [Phaseolus vulgaris] 64 2e-08 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-l... 64 3e-08 emb|CBI15540.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protei... 63 4e-08 ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protei... 62 6e-08 gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein... 62 8e-08 gb|ABK26798.1| unknown [Picea sitchensis] gi|224286069|gb|ACN407... 62 8e-08 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [... 62 1e-07 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus pe... 62 1e-07 ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protei... 60 3e-07 ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis... 60 3e-07 >sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|2385376|emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia] Length = 325 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein [Glycine max] gi|3023858|sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein gi|1256608|gb|AAB05941.1| G beta-like protein [Glycine max] Length = 325 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|AFK36580.1| unknown [Medicago truncatula] Length = 325 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein [Medicago truncatula] gi|355525093|gb|AET05547.1| Guanine nucleotide-binding protein subunit beta-like protein [Medicago truncatula] Length = 325 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max] gi|255645048|gb|ACU23023.1| unknown [Glycine max] Length = 325 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|ACJ85349.1| unknown [Medicago truncatula] Length = 285 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|ACJ85009.1| unknown [Medicago truncatula] Length = 219 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|AGV54321.1| RACK1 [Phaseolus vulgaris] Length = 324 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WQLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|ACV72060.1| RACK1 [Phaseolus vulgaris] gi|561033921|gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris] Length = 324 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WQLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|ACJ24167.1| Rack [Phaseolus vulgaris] Length = 324 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L KEDK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WQLTKEDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein [Morus notabilis] Length = 330 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KEDK +GVP+RRLTGHSHFV+DVVLSSD Q ++ Sbjct: 44 WHLTKEDKAYGVPRRRLTGHSHFVEDVVLSSDSQFAL 80 >emb|CBI15540.3| unnamed protein product [Vitis vinifera] Length = 1318 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L K+DK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 1098 WHLTKDDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 1134 >ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like protein isoform 1 [Vitis vinifera] gi|359491001|ref|XP_003634197.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like protein isoform 2 [Vitis vinifera] gi|147784318|emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera] Length = 327 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L K+DK +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKDDKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like protein-like [Cicer arietinum] Length = 317 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KE+K +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEEKVYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta [Eschscholzia californica] Length = 313 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L KED +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKEDPTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >gb|ABK26798.1| unknown [Picea sitchensis] gi|224286069|gb|ACN40746.1| unknown [Picea sitchensis] gi|224286410|gb|ACN40912.1| unknown [Picea sitchensis] Length = 316 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 WNL KE +++GVP+RRLTGHSHFVQDVV+SSD Q ++ Sbjct: 43 WNLTKEPEKYGVPRRRLTGHSHFVQDVVISSDGQFAL 79 >gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 327 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L K++K +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 45 WQLTKDEKTYGVPRRRLTGHSHFVQDVVLSSDSQFAL 81 >gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica] Length = 327 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W+L K++K +GVP+RRLTGHSHFVQDVVLSSD Q ++ Sbjct: 43 WHLTKDEKTYGVPRRRLTGHSHFVQDVVLSSDGQFAL 79 >ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like protein-like [Cucumis sativus] gi|449497541|ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like protein-like [Cucumis sativus] Length = 327 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L KE+K +GVP+RRL GHSHFVQDVVLSSD Q ++ Sbjct: 43 WRLTKEEKTYGVPQRRLNGHSHFVQDVVLSSDGQFAL 79 >ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana] gi|75333344|sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like protein B; AltName: Full=Receptor for activated C kinase 1B gi|12321595|gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana] gi|12597816|gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana] gi|16604557|gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana] gi|20259151|gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana] gi|332194208|gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana] Length = 326 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 257 WNLVKEDKQFGVPKRRLTGHSHFVQDVVLSSDVQLSI 367 W L KEDK +GV +RR+TGHSHFVQDVVLSSD Q ++ Sbjct: 43 WKLTKEDKSYGVAQRRMTGHSHFVQDVVLSSDGQFAL 79