BLASTX nr result
ID: Achyranthes22_contig00057737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057737 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB10790.1| retroelement pol polyprotein-like [Arabidopsis t... 186 3e-50 gb|ACY01934.1| hypothetical protein [Beta vulgaris] 184 2e-49 gb|AAL06421.1|AF378079_1 reverse transcriptase [Arabidopsis thal... 183 3e-49 gb|AAL06419.1|AF378075_1 reverse transcriptase [Arabidopsis thal... 182 4e-49 gb|AAF24531.1|AC007534_12 F7F22.17 [Arabidopsis thaliana] 182 8e-49 gb|AAF24529.1|AC007534_10 F7F22.15 [Arabidopsis thaliana] 181 1e-48 emb|CAD12891.1| reverse transcriptase [Brassica oleracea var. bo... 180 1e-48 gb|AAL06422.1|AF378081_1 reverse transcriptase [Arabidopsis thal... 181 2e-48 gb|AAL06416.1|AF378057_1 reverse transcriptase [Sorghum bicolor] 177 2e-48 dbj|BAB02630.1| retroelement pol polyprotein-like [Arabidopsis t... 180 2e-48 gb|AAL06420.1|AF378078_1 reverse transcriptase [Arabidopsis thal... 182 2e-48 ref|XP_004288740.1| PREDICTED: uncharacterized protein LOC101297... 177 8e-48 ref|XP_004289462.1| PREDICTED: uncharacterized protein LOC101311... 177 1e-47 gb|AAL06401.1|AF378016_1 reverse transcriptase [Oryza sativa] 175 1e-47 gb|AAF79809.1|AC020646_32 T32E20.9 [Arabidopsis thaliana] 179 4e-47 pir||F85074 hypothetical protein AT4g07600 [imported] - Arabidop... 180 4e-47 ref|XP_006493879.1| PREDICTED: uncharacterized protein LOC102616... 174 5e-47 dbj|BAA22787.1| reverse transcriptase-like protein [Vicia faba] 176 5e-47 gb|AAL06410.1|AF378034_1 reverse transcriptase [Triticum aestivum] 172 7e-47 emb|CAD39882.2| OSJNBb0067G11.5 [Oryza sativa Japonica Group] 172 1e-46 >dbj|BAB10790.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 1864 Score = 186 bits (473), Expect(2) = 3e-50 Identities = 82/105 (78%), Positives = 96/105 (91%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 1051 DQMLERLANHPYYCFLDGYSGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 1110 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFSV GS F +CL NL VLKRC+ Sbjct: 1111 QRCMTSIFSDLIEEMVEVFMDDFSVYGSSFSSCLLNLCRVLKRCE 1155 Score = 37.7 bits (86), Expect(2) = 3e-50 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 1031 IDYRKLNAASRKDHFPLPF 1049 >gb|ACY01934.1| hypothetical protein [Beta vulgaris] Length = 1717 Score = 184 bits (467), Expect(2) = 2e-49 Identities = 82/105 (78%), Positives = 93/105 (88%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H++FC+LDGYSGFFQ+PIHPDDQEKTTFTCP+GTFAYRRMPFGLCNAP+TF Sbjct: 967 DQMLERLACHSHFCYLDGYSGFFQIPIHPDDQEKTTFTCPYGTFAYRRMPFGLCNAPATF 1026 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM AIFS+ +E +E+FMDDFSV G FD CL NL VLKRC+ Sbjct: 1027 QRCMMAIFSEFIESIMEIFMDDFSVYGINFDACLLNLTKVLKRCE 1071 Score = 37.7 bits (86), Expect(2) = 2e-49 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN T+KDH+PLPF Sbjct: 947 IDYRKLNVATKKDHFPLPF 965 >gb|AAL06421.1|AF378079_1 reverse transcriptase [Arabidopsis thaliana] Length = 254 Score = 183 bits (465), Expect(2) = 3e-49 Identities = 81/105 (77%), Positives = 95/105 (90%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 78 DQMLERLANHPYYCFLDGYSGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++I SD++E+ +EVFMDDFSV GS F +CL NL VLKRC+ Sbjct: 138 QRCMTSISSDLIEEMVEVFMDDFSVYGSSFSSCLLNLCRVLKRCE 182 Score = 37.7 bits (86), Expect(2) = 3e-49 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 58 IDYRKLNAASRKDHFPLPF 76 >gb|AAL06419.1|AF378075_1 reverse transcriptase [Arabidopsis thaliana] Length = 254 Score = 182 bits (463), Expect(2) = 4e-49 Identities = 82/105 (78%), Positives = 94/105 (89%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA HT++CFLDGYSGFFQ+PIHP+DQEKTTFTCP GTFAYRRMPFGLCNAP+TF Sbjct: 78 DQMLERLANHTHYCFLDGYSGFFQIPIHPNDQEKTTFTCPCGTFAYRRMPFGLCNAPATF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IFSD++E+ +EV MDDFSV G F +CLSNL VLKRC+ Sbjct: 138 QRCMMSIFSDLIENVVEVLMDDFSVYGDSFASCLSNLCRVLKRCE 182 Score = 37.7 bits (86), Expect(2) = 4e-49 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 58 IDYRKLNAASRKDHFPLPF 76 >gb|AAF24531.1|AC007534_12 F7F22.17 [Arabidopsis thaliana] Length = 1799 Score = 182 bits (461), Expect(2) = 8e-49 Identities = 79/105 (75%), Positives = 94/105 (89%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGY+GFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 1036 DQMLERLANHPYYCFLDGYNGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 1095 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFSV G F +CL NL VL RC+ Sbjct: 1096 QRCMTSIFSDLIEEMVEVFMDDFSVYGPSFSSCLLNLGRVLTRCE 1140 Score = 37.7 bits (86), Expect(2) = 8e-49 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 1016 IDYRKLNAASRKDHFPLPF 1034 >gb|AAF24529.1|AC007534_10 F7F22.15 [Arabidopsis thaliana] Length = 1862 Score = 181 bits (460), Expect(2) = 1e-48 Identities = 79/105 (75%), Positives = 94/105 (89%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 1050 DQMLERLANHPYYCFLDGYSGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 1109 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++++ +EVFMDDFSV G F +CL NL VL RC+ Sbjct: 1110 QRCMTSIFSDLIKEMVEVFMDDFSVYGPSFSSCLLNLGRVLTRCE 1154 Score = 37.7 bits (86), Expect(2) = 1e-48 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 1030 IDYRKLNAASRKDHFPLPF 1048 >emb|CAD12891.1| reverse transcriptase [Brassica oleracea var. botrytis] Length = 139 Score = 180 bits (456), Expect(2) = 1e-48 Identities = 80/105 (76%), Positives = 94/105 (89%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+DQEKTTFTCP+ TFAYRRMPFGLCNAP+TF Sbjct: 24 DQMLERLANHPYYCFLDGYSGFFQIPIHPEDQEKTTFTCPYVTFAYRRMPFGLCNAPATF 83 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IF+D++ED +EVFMD+FSV GS F CL+NL VL+RC+ Sbjct: 84 QRCMMSIFTDLIEDIMEVFMDNFSVYGSSFTDCLANLCRVLERCE 128 Score = 39.3 bits (90), Expect(2) = 1e-48 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 +DYRKLN TRKDH+PLPF Sbjct: 4 VDYRKLNSATRKDHFPLPF 22 >gb|AAL06422.1|AF378081_1 reverse transcriptase [Arabidopsis thaliana] Length = 254 Score = 181 bits (458), Expect(2) = 2e-48 Identities = 79/105 (75%), Positives = 93/105 (88%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+C LDGYSGFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 78 DQMLERLANHPYYCLLDGYSGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFSV G F +CL NL VL RC+ Sbjct: 138 QRCMTSIFSDLIEEMVEVFMDDFSVYGPSFSSCLLNLGRVLTRCE 182 Score = 37.7 bits (86), Expect(2) = 2e-48 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 58 IDYRKLNAASRKDHFPLPF 76 >gb|AAL06416.1|AF378057_1 reverse transcriptase [Sorghum bicolor] Length = 254 Score = 177 bits (448), Expect(2) = 2e-48 Identities = 76/105 (72%), Positives = 93/105 (88%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 D+MLERLA H++FCFLDGYSG+ Q+PIHPDDQ KTTFTCP+GT+AYRRM FGLCNAP++F Sbjct: 78 DEMLERLANHSFFCFLDGYSGYHQIPIHPDDQSKTTFTCPYGTYAYRRMSFGLCNAPASF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IFSDM+E+ +EVFMDDFSV G FD+CL NL+ VL+ C+ Sbjct: 138 QRCMMSIFSDMIEEIMEVFMDDFSVYGKAFDSCLENLDKVLQSCE 182 Score = 41.6 bits (96), Expect(2) = 2e-48 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLNK TRKDH+PLPF Sbjct: 58 IDYRKLNKATRKDHFPLPF 76 >dbj|BAB02630.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 897 Score = 180 bits (457), Expect(2) = 2e-48 Identities = 79/105 (75%), Positives = 93/105 (88%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+DQEKTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 134 DQMLERLANHPYYCFLDGYSGFFQIPIHPNDQEKTTFTCPYGTFAYKRMPFGLCNAPATF 193 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFS G F +CL NL VL RC+ Sbjct: 194 QRCMTSIFSDLIEEMVEVFMDDFSGYGPSFSSCLLNLGRVLTRCE 238 Score = 37.7 bits (86), Expect(2) = 2e-48 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+PLPF Sbjct: 114 IDYRKLNAASRKDHFPLPF 132 >gb|AAL06420.1|AF378078_1 reverse transcriptase [Arabidopsis thaliana] Length = 254 Score = 182 bits (463), Expect(2) = 2e-48 Identities = 82/105 (78%), Positives = 94/105 (89%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA HT++CFLDGYSGFFQ+PIHP+DQEKTTFTCP GTFAYRRMPFGLCNAP+TF Sbjct: 78 DQMLERLANHTHYCFLDGYSGFFQIPIHPNDQEKTTFTCPCGTFAYRRMPFGLCNAPATF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IFSD++E+ +EV MDDFSV G F +CLSNL VLKRC+ Sbjct: 138 QRCMMSIFSDLIENVVEVLMDDFSVYGDSFASCLSNLCRVLKRCE 182 Score = 35.4 bits (80), Expect(2) = 2e-48 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN +RKDH+P PF Sbjct: 58 IDYRKLNAASRKDHFPSPF 76 >ref|XP_004288740.1| PREDICTED: uncharacterized protein LOC101297673 [Fragaria vesca subsp. vesca] Length = 1058 Score = 177 bits (448), Expect(2) = 8e-48 Identities = 81/104 (77%), Positives = 90/104 (86%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H ++CFLDGYSG+ QM I +DQEKTTFTCPFGTFAYRRMPFGLCNAP TF Sbjct: 426 DQMLERLAGHEFYCFLDGYSGYNQMCIAQEDQEKTTFTCPFGTFAYRRMPFGLCNAPGTF 485 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRC 371 QRCM +IFSD +E+ IEVFMDDFSV G FD+CL NLEL+LKRC Sbjct: 486 QRCMMSIFSDYIENIIEVFMDDFSVFGKNFDSCLKNLELILKRC 529 Score = 39.3 bits (90), Expect(2) = 8e-48 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN TRKDH+PLPF Sbjct: 406 IDYRKLNATTRKDHFPLPF 424 >ref|XP_004289462.1| PREDICTED: uncharacterized protein LOC101311522 [Fragaria vesca subsp. vesca] Length = 1109 Score = 177 bits (449), Expect(2) = 1e-47 Identities = 80/105 (76%), Positives = 92/105 (87%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSG+ Q+PI P+DQEKTTFTCP+GTFAYRRMPFGLCNAP+TF Sbjct: 471 DQMLERLASHEYYCFLDGYSGYNQIPIAPEDQEKTTFTCPYGTFAYRRMPFGLCNAPATF 530 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM IFSDM+E IEVFMDDFSV G F+ CL +LELVL++C+ Sbjct: 531 QRCMITIFSDMVEKFIEVFMDDFSVFGDSFNQCLHHLELVLQKCE 575 Score = 38.5 bits (88), Expect(2) = 1e-47 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN T+KDH+PLPF Sbjct: 451 IDYRKLNNATKKDHFPLPF 469 >gb|AAL06401.1|AF378016_1 reverse transcriptase [Oryza sativa] Length = 254 Score = 175 bits (443), Expect(2) = 1e-47 Identities = 76/105 (72%), Positives = 91/105 (86%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 D+MLERLA H++FCFLDGYSG+ Q+PIHP+DQ KTTFTCP+GT+AYRRMPFGLCN P++F Sbjct: 78 DEMLERLANHSFFCFLDGYSGYHQIPIHPEDQSKTTFTCPYGTYAYRRMPFGLCNTPASF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IFSDM+ED +EVFMDDFSV G CL NL+ VL+RCQ Sbjct: 138 QRCMMSIFSDMIEDIMEVFMDDFSVYGKTLGHCLQNLDKVLQRCQ 182 Score = 40.4 bits (93), Expect(2) = 1e-47 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLNK T+KDH+PLPF Sbjct: 58 IDYRKLNKATKKDHFPLPF 76 >gb|AAF79809.1|AC020646_32 T32E20.9 [Arabidopsis thaliana] Length = 1586 Score = 179 bits (455), Expect(2) = 4e-47 Identities = 79/105 (75%), Positives = 93/105 (88%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 D MLERLA H Y+CFLD YSGFFQ+PIHP+DQ KTTFTCP+GTFAY+RMPFGLCNAP+TF Sbjct: 901 DHMLERLANHPYYCFLDSYSGFFQIPIHPNDQGKTTFTCPYGTFAYKRMPFGLCNAPATF 960 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFSV GS F +CL NL VLKRC+ Sbjct: 961 QRCMTSIFSDLIEEMVEVFMDDFSVYGSSFSSCLLNLCRVLKRCE 1005 Score = 34.3 bits (77), Expect(2) = 4e-47 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 I+YRKLN +RK+H+PLPF Sbjct: 881 IEYRKLNVASRKEHFPLPF 899 >pir||F85074 hypothetical protein AT4g07600 [imported] - Arabidopsis thaliana gi|5724765|gb|AAD48069.1|AF160181_1 contains similarity to Pfam family PF00078 -943 Reverse transcriptase (RNA-dependent DNA polymerase); score 65.8, E=9.4e-16, N=1; may be a pseudogene [Arabidopsis thaliana] gi|7267357|emb|CAB81130.1| AT4g07600 [Arabidopsis thaliana] Length = 630 Score = 180 bits (456), Expect(2) = 4e-47 Identities = 79/105 (75%), Positives = 92/105 (87%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSGFFQ+PIHP+D EKTTFTCP+GTFAY RMPFGLCNAP+TF Sbjct: 379 DQMLERLANHPYYCFLDGYSGFFQIPIHPNDHEKTTFTCPYGTFAYERMPFGLCNAPATF 438 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM++IFSD++E+ +EVFMDDFSV G F +CL NL VL RC+ Sbjct: 439 QRCMTSIFSDIIEEMVEVFMDDFSVYGPSFSSCLLNLGRVLTRCE 483 Score = 33.9 bits (76), Expect(2) = 4e-47 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYR LN +R DH+PLPF Sbjct: 359 IDYRNLNAASRNDHFPLPF 377 >ref|XP_006493879.1| PREDICTED: uncharacterized protein LOC102616274 [Citrus sinensis] Length = 1170 Score = 174 bits (441), Expect(2) = 5e-47 Identities = 79/104 (75%), Positives = 91/104 (87%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERL+ H+++CFLDGYSG+ Q+ I P+DQEKTTFTCPFGTFAYRRMPFGLCNAP+TF Sbjct: 912 DQMLERLSGHSHYCFLDGYSGYNQIVITPEDQEKTTFTCPFGTFAYRRMPFGLCNAPATF 971 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRC 371 QRCM +IFSD +E+ IEVFMDDF+V G FD CL NL LVLKRC Sbjct: 972 QRCMMSIFSDYVENIIEVFMDDFTVYGDSFDKCLDNLTLVLKRC 1015 Score = 39.3 bits (90), Expect(2) = 5e-47 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLN TRKDH+PLPF Sbjct: 892 IDYRKLNAATRKDHFPLPF 910 >dbj|BAA22787.1| reverse transcriptase-like protein [Vicia faba] Length = 407 Score = 176 bits (445), Expect(2) = 5e-47 Identities = 79/105 (75%), Positives = 91/105 (86%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERLA H Y+CFLDGYSG+ Q+ + P+DQEKTTFTCPFG F+YRR+PFGLCNAP+TF Sbjct: 23 DQMLERLADHEYYCFLDGYSGYNQIAVVPEDQEKTTFTCPFGIFSYRRIPFGLCNAPATF 82 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IF+DMLE +EVFMDDFSV G FD CLSNL LVL+RCQ Sbjct: 83 QRCMQSIFADMLEKYMEVFMDDFSVFGKSFDNCLSNLALVLERCQ 127 Score = 37.7 bits (86), Expect(2) = 5e-47 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYR+LN TRKDH+PLPF Sbjct: 3 IDYRRLNLATRKDHFPLPF 21 >gb|AAL06410.1|AF378034_1 reverse transcriptase [Triticum aestivum] Length = 254 Score = 172 bits (437), Expect(2) = 7e-47 Identities = 79/105 (75%), Positives = 88/105 (83%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 DQMLERL +HT++CFLDGYSGF Q+P+ DQ KTTFTCPFGTFAYRRMPFGLCNAPSTF Sbjct: 78 DQMLERLCKHTHYCFLDGYSGFSQIPVSAKDQSKTTFTCPFGTFAYRRMPFGLCNAPSTF 137 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM AIFSD E EVFMD+FSV GS FD CLSN + VL+RC+ Sbjct: 138 QRCMMAIFSDFCEKICEVFMDEFSVYGSSFDDCLSNPDRVLQRCE 182 Score = 40.4 bits (93), Expect(2) = 7e-47 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 ID+RKLNK T+KDHYPLPF Sbjct: 58 IDFRKLNKATKKDHYPLPF 76 >emb|CAD39882.2| OSJNBb0067G11.5 [Oryza sativa Japonica Group] Length = 791 Score = 172 bits (435), Expect(2) = 1e-46 Identities = 75/105 (71%), Positives = 90/105 (85%) Frame = +3 Query: 60 DQMLERLAQHTYFCFLDGYSGFFQMPIHPDDQEKTTFTCPFGTFAYRRMPFGLCNAPSTF 239 D+MLERLA H++FCFLDGYSG+ Q+PIHP+DQ KTTFTCP+GT+AYRRM FGLCN P++F Sbjct: 533 DEMLERLANHSFFCFLDGYSGYHQIPIHPEDQSKTTFTCPYGTYAYRRMSFGLCNTPASF 592 Query: 240 QRCMSAIFSDMLEDCIEVFMDDFSVGGSGFDTCLSNLELVLKRCQ 374 QRCM +IFSDM+ED +EVFMDDFSV G CL NL+ VL+RCQ Sbjct: 593 QRCMMSIFSDMIEDIMEVFMDDFSVYGKTLGHCLQNLDKVLQRCQ 637 Score = 40.4 bits (93), Expect(2) = 1e-46 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 2 IDYRKLNKHTRKDHYPLPF 58 IDYRKLNK T+KDH+PLPF Sbjct: 513 IDYRKLNKATKKDHFPLPF 531