BLASTX nr result
ID: Achyranthes22_contig00057640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057640 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW27825.1| hypothetical protein PHAVU_003G235200g [Phaseolus... 57 2e-06 ref|XP_003632489.1| PREDICTED: uncharacterized protein LOC100855... 55 7e-06 >gb|ESW27825.1| hypothetical protein PHAVU_003G235200g [Phaseolus vulgaris] Length = 92 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -1 Query: 166 LLANIIGGLGYCMTTLWGLQERRFSTVFDAVNSAARYMTMGLVFCFVSLQ 17 LLA ++ G+G + TLW LQERR+S FDAV SA +TM LVFCF+S++ Sbjct: 26 LLAMVVDGVGGFVKTLWALQERRWSYTFDAVASAVVSVTMTLVFCFLSIR 75 >ref|XP_003632489.1| PREDICTED: uncharacterized protein LOC100855071 [Vitis vinifera] Length = 39 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -1 Query: 172 AILLANIIGGLGYCMTTLWGLQERRFSTVFDAVNSAA 62 A+LLA ++ LG C+TTLW LQERRFST+F+ V+SAA Sbjct: 2 AVLLAMVVDALGLCVTTLWDLQERRFSTIFETVSSAA 38