BLASTX nr result
ID: Achyranthes22_contig00057569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057569 (646 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBJ20729.1| hypothetical protein [Beta vulgaris subsp. marit... 59 1e-06 >emb|CBJ20729.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 224 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -1 Query: 589 GVETQFSDDRVKLQFELEKRLEYTLREDCFTKNSITETRCEWRREA 452 G E F+ + V LQF LE +LEY LRE+ F+++SI ETRCEWRR A Sbjct: 114 GFEPSFNGELVNLQFRLELKLEYALREEGFSESSIMETRCEWRRAA 159