BLASTX nr result
ID: Achyranthes22_contig00057191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057191 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW33926.1| hypothetical protein PHAVU_001G110000g [Phaseolus... 56 6e-06 >gb|ESW33926.1| hypothetical protein PHAVU_001G110000g [Phaseolus vulgaris] gi|561035397|gb|ESW33927.1| hypothetical protein PHAVU_001G110000g [Phaseolus vulgaris] Length = 590 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/88 (39%), Positives = 45/88 (51%) Frame = +2 Query: 2 NLSRKLWNPENGYVDVSLKDGFFSELTHESHRSYASSEHEGSDCRRSYVNGFPGFTPGSA 181 +++RKLW+ ENG VDVSLKDG FS + ES S SS HE Y F GF + Sbjct: 362 SVTRKLWSNENGGVDVSLKDGLFSRVVKESSLSEHSSIHEFPSGDGYYTEEFAGFMDRNP 421 Query: 182 ANEALRNRPQSSVNGALRSRPQSPAKGV 265 + R S+ LRSR Q+ + Sbjct: 422 RHGVSR----STTTSPLRSRTQATVDSI 445