BLASTX nr result
ID: Achyranthes22_contig00057137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00057137 (248 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|5... 63 5e-08 ref|XP_002323690.1| hypothetical protein POPTR_0016s14840g [Popu... 62 6e-08 gb|EOY04377.1| Auxin efflux carrier family protein isoform 2 [Th... 62 8e-08 gb|EOY04376.1| Auxin efflux carrier family protein isoform 1 [Th... 62 8e-08 ref|XP_002267734.1| PREDICTED: uncharacterized transporter YBR28... 58 1e-06 ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR28... 58 1e-06 tpg|DAA57098.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea m... 57 2e-06 gb|AFK32351.1| putative auxin efflux carrier-like protein PINY [... 57 2e-06 gb|AFK47877.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_002456536.1| hypothetical protein SORBIDRAFT_03g038030 [S... 57 2e-06 gb|ACF82206.1| unknown [Zea mays] gi|414879966|tpg|DAA57097.1| T... 57 2e-06 ref|XP_002531815.1| auxin:hydrogen symporter, putative [Ricinus ... 57 3e-06 ref|XP_004970374.1| PREDICTED: uncharacterized transporter YBR28... 57 3e-06 ref|XP_006481258.1| PREDICTED: uncharacterized transporter YBR28... 56 6e-06 ref|XP_006429653.1| hypothetical protein CICLE_v10011730mg [Citr... 56 6e-06 gb|EPS68823.1| auxin efflux carrier component, auxin transport p... 55 1e-05 ref|XP_004492601.1| PREDICTED: uncharacterized transporter YBR28... 55 1e-05 >ref|XP_002326270.1| predicted protein [Populus trichocarpa] gi|566175683|ref|XP_006381274.1| hypothetical protein POPTR_0006s11290g [Populus trichocarpa] gi|550335975|gb|ERP59071.1| hypothetical protein POPTR_0006s11290g [Populus trichocarpa] Length = 412 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 136 MNRMLLVLMGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R L ++ Q GG+SLL+TIK+A+LPIAKVFTMCFLGFLMA Sbjct: 1 MERFLSAMVPVGNQAGGQSLLNTIKIAVLPIAKVFTMCFLGFLMA 45 >ref|XP_002323690.1| hypothetical protein POPTR_0016s14840g [Populus trichocarpa] gi|222868320|gb|EEF05451.1| hypothetical protein POPTR_0016s14840g [Populus trichocarpa] Length = 414 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVL--MGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL + MG+ GGG++LL TIK+A+LPIAKVFTMCFLGFLMA Sbjct: 1 MERFLLAVDTMGANQVGGGQTLLGTIKIAVLPIAKVFTMCFLGFLMA 47 >gb|EOY04377.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] Length = 414 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 136 MNRMLLVLMGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R+L +M + GGESLL +IK+A+LPIAKVFTMCFLGFLMA Sbjct: 1 MERVLSAVMEAPAAAGGESLLGSIKIAVLPIAKVFTMCFLGFLMA 45 >gb|EOY04376.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 412 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -2 Query: 136 MNRMLLVLMGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R+L +M + GGESLL +IK+A+LPIAKVFTMCFLGFLMA Sbjct: 1 MERVLSAVMEAPAAAGGESLLGSIKIAVLPIAKVFTMCFLGFLMA 45 >ref|XP_002267734.1| PREDICTED: uncharacterized transporter YBR287W [Vitis vinifera] Length = 405 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 97 QGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 + GGESLL TIK+A+LPIAKVFTMCFLGFLMA Sbjct: 7 ENGGESLLGTIKIAVLPIAKVFTMCFLGFLMA 38 >ref|XP_004142666.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] gi|449502666|ref|XP_004161708.1| PREDICTED: uncharacterized transporter YBR287W-like [Cucumis sativus] Length = 411 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 106 SATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 S Q GG SLL TIK+A+LPIAKVFTMCFLGFLMA Sbjct: 10 SEVQAGGNSLLVTIKIAVLPIAKVFTMCFLGFLMA 44 >tpg|DAA57098.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea mays] Length = 335 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVLMGSATQGG--GESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL ++ +A QGG G S+LS +K A+LPIAKVFT+CF+GFLMA Sbjct: 2 MERSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMA 48 >gb|AFK32351.1| putative auxin efflux carrier-like protein PINY [Zea mays] gi|414879968|tpg|DAA57099.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea mays] Length = 433 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVLMGSATQGG--GESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL ++ +A QGG G S+LS +K A+LPIAKVFT+CF+GFLMA Sbjct: 2 MERSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMA 48 >gb|AFK47877.1| unknown [Lotus japonicus] Length = 418 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -2 Query: 136 MNRMLLVLMGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL L GG ESLL +IK+A+LPI KVFTMCFLGFLMA Sbjct: 5 MGRFLLALQNQGGSGG-ESLLGSIKIAVLPIVKVFTMCFLGFLMA 48 >ref|XP_002456536.1| hypothetical protein SORBIDRAFT_03g038030 [Sorghum bicolor] gi|241928511|gb|EES01656.1| hypothetical protein SORBIDRAFT_03g038030 [Sorghum bicolor] Length = 433 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVLMGSATQGG--GESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL ++ +A QGG G S+LS +K A+LPIAKVFT+CF+GFLMA Sbjct: 2 MERSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMA 48 >gb|ACF82206.1| unknown [Zea mays] gi|414879966|tpg|DAA57097.1| TPA: hypothetical protein ZEAMMB73_854946 [Zea mays] Length = 73 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVLMGSATQGG--GESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL ++ +A QGG G S+LS +K A+LPIAKVFT+CF+GFLMA Sbjct: 2 MERSLLEVLATAAQGGTEGTSVLSMLKYAVLPIAKVFTVCFMGFLMA 48 >ref|XP_002531815.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223528549|gb|EEF30572.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 416 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 136 MNRMLLVLMGSATQGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R L ++ Q G+SL+ TI++A+LPIAKVFTMCFLGFLMA Sbjct: 5 MERFLSAVVSMDNQVAGQSLIGTIRIAVLPIAKVFTMCFLGFLMA 49 >ref|XP_004970374.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Setaria italica] gi|514783563|ref|XP_004970375.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Setaria italica] Length = 435 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -2 Query: 136 MNRMLLVLMGSATQGG--GESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M R LL + +A QGG G S+LS +K A+LPIAKVFT+CF+GFLMA Sbjct: 2 MERSLLQALATAAQGGTSGTSVLSMLKYAVLPIAKVFTVCFMGFLMA 48 >ref|XP_006481258.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X2 [Citrus sinensis] Length = 414 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 97 QGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 + GGESLL T+K+A+LPIAKVFT+CFLGFLMA Sbjct: 14 KAGGESLLGTVKIAVLPIAKVFTICFLGFLMA 45 >ref|XP_006429653.1| hypothetical protein CICLE_v10011730mg [Citrus clementina] gi|568855325|ref|XP_006481257.1| PREDICTED: uncharacterized transporter YBR287W-like isoform X1 [Citrus sinensis] gi|557531710|gb|ESR42893.1| hypothetical protein CICLE_v10011730mg [Citrus clementina] Length = 442 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 97 QGGGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 + GGESLL T+K+A+LPIAKVFT+CFLGFLMA Sbjct: 14 KAGGESLLGTVKIAVLPIAKVFTICFLGFLMA 45 >gb|EPS68823.1| auxin efflux carrier component, auxin transport protein, partial [Genlisea aurea] Length = 425 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 91 GGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 GGES+L +IK+A+LPIAKVFTMCFLGFLMA Sbjct: 20 GGESILGSIKIAVLPIAKVFTMCFLGFLMA 49 >ref|XP_004492601.1| PREDICTED: uncharacterized transporter YBR287W-like [Cicer arietinum] Length = 422 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -2 Query: 136 MNRMLLVLMGSATQG-GGESLLSTIKMALLPIAKVFTMCFLGFLMA 2 M M +L+ QG GGESLL +IK+A+LPI KVFTMCFLG LMA Sbjct: 2 MGTMERLLLAMENQGPGGESLLGSIKIAVLPIVKVFTMCFLGLLMA 47