BLASTX nr result
ID: Achyranthes22_contig00056885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00056885 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139751.1| PREDICTED: F-box/kelch-repeat protein At3g23... 58 2e-06 ref|XP_002521772.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_004139751.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cucumis sativus] Length = 401 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 1/91 (1%) Frame = +3 Query: 3 WVLKELDGSEWVKQHTIHIDPILGHVEIEEYLLPCFALNAKVMIFRRRD-MFYSYDFELE 179 W+LK L G W+KQH+I+I + V + + + +IF+ +D FY YDFEL Sbjct: 317 WILKGLSGEIWIKQHSINIGCRMDMVPLLSFRI------RGDLIFKSKDGFFYIYDFELR 370 Query: 180 EIKEVEMDQGRKFLPHEILLPHSNNLATWET 272 I +VE D+ R + + L PH N++ +W + Sbjct: 371 SITKVE-DKKRLRVSSDFLFPHVNSMVSWSS 400 >ref|XP_002521772.1| conserved hypothetical protein [Ricinus communis] gi|223538985|gb|EEF40582.1| conserved hypothetical protein [Ricinus communis] Length = 413 Score = 57.8 bits (138), Expect = 2e-06 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 3/98 (3%) Frame = +3 Query: 3 WVLKELDGSEWVKQHTIHIDPILGHVEIEEYLLPCFALNAKVMIFRRRD--MFYSYDFEL 176 W L+ L G W KQ++I I+ V I C +IF+R + FYSYD L Sbjct: 323 WNLRSLSGDVWTKQYSITRGSIIDMVPI------CSLRIGGELIFKRDEDGSFYSYDCRL 376 Query: 177 EEIKEVEMDQGRKFLP-HEILLPHSNNLATWETLESMS 287 +E+++VEMD +K LP H LPH N+L +W ++ S Sbjct: 377 KEMRKVEMD--KKCLPFHGTYLPHVNSLISWVKIQDAS 412