BLASTX nr result
ID: Achyranthes22_contig00056874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00056874 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59174.1| hypothetical protein M569_15636 [Genlisea aurea] 55 7e-06 >gb|EPS59174.1| hypothetical protein M569_15636 [Genlisea aurea] Length = 375 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 3 ALAIAAMCLQEEEAARPMITDVVTAIMYLSSQNLNDHNSNSPPSEL 140 ALA+AAMC+QE+ RP+I DVVTA+ YL+SQ DH + PP++L Sbjct: 319 ALAVAAMCVQEQPNLRPLIADVVTALTYLASQKF-DHEAQPPPAQL 363