BLASTX nr result
ID: Achyranthes22_contig00056858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00056858 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX65457.1| 30S ribosomal protein S2 [Portulaca oleracea] 112 5e-23 gb|AEX65455.1| 30S ribosomal protein S2 [Portulacaria afra] 112 5e-23 gb|AEX65453.1| 30S ribosomal protein S2 [Mollugo verticillata] 112 5e-23 gb|AEX65451.1| 30S ribosomal protein S2 [Didierea madagascariensis] 112 5e-23 gb|AEX65449.1| 30S ribosomal protein S2 [Anredera baselloides] 112 5e-23 ref|YP_009000165.1| ribosomal protein S2 (chloroplast) [Silene p... 110 2e-22 ref|YP_008999924.1| ribosomal protein S2 (chloroplast) [Agrostem... 110 2e-22 gb|AHE41674.1| ribosomal protein S2 (chloroplast) [Itea chinensis] 110 2e-22 gb|AHE41671.1| ribosomal protein S2 (chloroplast) [Ribes fascicu... 110 2e-22 ref|YP_008578077.1| ribosomal protein S2 (chloroplast) [Allosync... 110 2e-22 ref|YP_008577822.1| ribosomal protein S2 (chloroplast) [Corymbia... 110 2e-22 ref|YP_008577482.1| ribosomal protein S2 (chloroplast) [Eucalypt... 110 2e-22 ref|YP_008576887.1| ribosomal protein S2 (chloroplast) [Eucalypt... 110 2e-22 ref|YP_008576717.1| ribosomal protein S2 (chloroplast) [Eucalypt... 110 2e-22 ref|YP_008576037.1| ribosomal protein S2 (chloroplast) [Eucalypt... 110 2e-22 ref|YP_008575357.1| ribosomal protein S2 (chloroplast) [Eucalypt... 110 2e-22 ref|YP_007889850.1| ribosomal protein S2 [Francoa sonchifolia] g... 110 2e-22 ref|YP_636288.1| ribosomal protein S2 [Eucalyptus globulus subsp... 110 2e-22 ref|NP_054921.1| ribosomal protein S2 [Spinacia oleracea] gi|133... 110 2e-22 gb|AFU95293.1| Rps2, partial (chloroplast) [Trigonia sp. CCD-2012] 110 2e-22 >gb|AEX65457.1| 30S ribosomal protein S2 [Portulaca oleracea] Length = 236 Score = 112 bits (280), Expect = 5e-23 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >gb|AEX65455.1| 30S ribosomal protein S2 [Portulacaria afra] Length = 236 Score = 112 bits (280), Expect = 5e-23 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >gb|AEX65453.1| 30S ribosomal protein S2 [Mollugo verticillata] Length = 236 Score = 112 bits (280), Expect = 5e-23 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >gb|AEX65451.1| 30S ribosomal protein S2 [Didierea madagascariensis] Length = 236 Score = 112 bits (280), Expect = 5e-23 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >gb|AEX65449.1| 30S ribosomal protein S2 [Anredera baselloides] Length = 236 Score = 112 bits (280), Expect = 5e-23 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >ref|YP_009000165.1| ribosomal protein S2 (chloroplast) [Silene paradoxa] gi|555944254|gb|AGZ18155.1| ribosomal protein S2 (chloroplast) [Silene paradoxa] Length = 236 Score = 110 bits (276), Expect = 2e-22 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAI+SIRLILTKLVF+ICEGRSSY+RNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAISSIRLILTKLVFAICEGRSSYVRNP 236 >ref|YP_008999924.1| ribosomal protein S2 (chloroplast) [Agrostemma githago] gi|555944010|gb|AGZ17914.1| ribosomal protein S2 (chloroplast) [Agrostemma githago] Length = 236 Score = 110 bits (276), Expect = 2e-22 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAI+SIRLILTKLVF+ICEGRSSY+RNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAISSIRLILTKLVFAICEGRSSYVRNP 236 >gb|AHE41674.1| ribosomal protein S2 (chloroplast) [Itea chinensis] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >gb|AHE41671.1| ribosomal protein S2 (chloroplast) [Ribes fasciculatum var. chinense] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008578077.1| ribosomal protein S2 (chloroplast) [Allosyncarpia ternata] gi|442569324|gb|AGC59486.1| ribosomal protein S2 (chloroplast) [Allosyncarpia ternata] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008577822.1| ribosomal protein S2 (chloroplast) [Corymbia tessellaris] gi|442569066|gb|AGC59231.1| ribosomal protein S2 (chloroplast) [Corymbia tessellaris] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008577482.1| ribosomal protein S2 (chloroplast) [Eucalyptus erythrocorys] gi|442568722|gb|AGC58891.1| ribosomal protein S2 (chloroplast) [Eucalyptus erythrocorys] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008576887.1| ribosomal protein S2 (chloroplast) [Eucalyptus deglupta] gi|442568120|gb|AGC58296.1| ribosomal protein S2 (chloroplast) [Eucalyptus deglupta] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008576717.1| ribosomal protein S2 (chloroplast) [Eucalyptus saligna] gi|442567948|gb|AGC58126.1| ribosomal protein S2 (chloroplast) [Eucalyptus saligna] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008576037.1| ribosomal protein S2 (chloroplast) [Eucalyptus patens] gi|442567088|gb|AGC57276.1| ribosomal protein S2 (chloroplast) [Eucalyptus patens] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_008575357.1| ribosomal protein S2 (chloroplast) [Eucalyptus verrucata] gi|545718728|ref|YP_008577567.1| ribosomal protein S2 (chloroplast) [Corymbia gummifera] gi|545718814|ref|YP_008577652.1| ribosomal protein S2 (chloroplast) [Corymbia maculata] gi|545718900|ref|YP_008577737.1| ribosomal protein S2 (chloroplast) [Corymbia eximia] gi|545719072|ref|YP_008577907.1| ribosomal protein S2 (chloroplast) [Angophora floribunda] gi|545719158|ref|YP_008577992.1| ribosomal protein S2 (chloroplast) [Angophora costata] gi|442566400|gb|AGC56596.1| ribosomal protein S2 (chloroplast) [Eucalyptus verrucata] gi|442568808|gb|AGC58976.1| ribosomal protein S2 (chloroplast) [Corymbia gummifera] gi|442568894|gb|AGC59061.1| ribosomal protein S2 (chloroplast) [Corymbia maculata] gi|442568980|gb|AGC59146.1| ribosomal protein S2 (chloroplast) [Corymbia eximia] gi|442569152|gb|AGC59316.1| ribosomal protein S2 (chloroplast) [Angophora floribunda] gi|442569238|gb|AGC59401.1| ribosomal protein S2 (chloroplast) [Angophora costata] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_007889850.1| ribosomal protein S2 [Francoa sonchifolia] gi|386268354|gb|AFJ00460.1| ribosomal protein S2 [Francoa sonchifolia] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|YP_636288.1| ribosomal protein S2 [Eucalyptus globulus subsp. globulus] gi|309322440|ref|YP_003933953.1| ribosomal protein S2 [Eucalyptus grandis] gi|545716234|ref|YP_008575102.1| ribosomal protein S2 (chloroplast) [Eucalyptus obliqua] gi|545716320|ref|YP_008575187.1| ribosomal protein S2 (chloroplast) [Eucalyptus radiata] gi|545716406|ref|YP_008575272.1| ribosomal protein S2 (chloroplast) [Eucalyptus delegatensis] gi|545716578|ref|YP_008575442.1| ribosomal protein S2 (chloroplast) [Eucalyptus baxteri] gi|545716664|ref|YP_008575527.1| ribosomal protein S2 (chloroplast) [Eucalyptus diversifolia] gi|545717008|ref|YP_008575867.1| ribosomal protein S2 (chloroplast) [Eucalyptus umbra] gi|545717266|ref|YP_008576122.1| ribosomal protein S2 (chloroplast) [Eucalyptus marginata] gi|545717352|ref|YP_008576207.1| ribosomal protein S2 (chloroplast) [Eucalyptus curtisii] gi|545717438|ref|YP_008576292.1| ribosomal protein S2 (chloroplast) [Eucalyptus melliodora] gi|545717524|ref|YP_008576377.1| ribosomal protein S2 (chloroplast) [Eucalyptus polybractea] gi|545717610|ref|YP_008576462.1| ribosomal protein S2 (chloroplast) [Eucalyptus cladocalyx] gi|545717696|ref|YP_008576547.1| ribosomal protein S2 (chloroplast) [Eucalyptus nitens] gi|545717782|ref|YP_008576632.1| ribosomal protein S2 (chloroplast) [Eucalyptus aromaphloia] gi|545718126|ref|YP_008576972.1| ribosomal protein S2 (chloroplast) [Eucalyptus spathulata] gi|545718212|ref|YP_008577057.1| ribosomal protein S2 (chloroplast) [Eucalyptus torquata] gi|545718298|ref|YP_008577142.1| ribosomal protein S2 (chloroplast) [Eucalyptus diversicolor] gi|545718384|ref|YP_008577227.1| ribosomal protein S2 (chloroplast) [Eucalyptus salmonophloia] gi|545718470|ref|YP_008577312.1| ribosomal protein S2 (chloroplast) [Eucalyptus microcorys] gi|545718556|ref|YP_008577397.1| ribosomal protein S2 (chloroplast) [Eucalyptus guilfoylei] gi|545719244|ref|YP_008578162.1| ribosomal protein S2 (chloroplast) [Stockwellia quadrifida] gi|122227188|sp|Q49L09.1|RR2_EUCGG RecName: Full=30S ribosomal protein S2, chloroplastic gi|60460798|gb|AAX21018.1| ribosomal protein S2 [Eucalyptus globulus subsp. globulus] gi|308223274|gb|ADO23582.1| ribosomal protein S2 [Eucalyptus grandis] gi|442566142|gb|AGC56341.1| ribosomal protein S2 (chloroplast) [Eucalyptus obliqua] gi|442566228|gb|AGC56426.1| ribosomal protein S2 (chloroplast) [Eucalyptus radiata] gi|442566314|gb|AGC56511.1| ribosomal protein S2 (chloroplast) [Eucalyptus delegatensis] gi|442566486|gb|AGC56681.1| ribosomal protein S2 (chloroplast) [Eucalyptus baxteri] gi|442566572|gb|AGC56766.1| ribosomal protein S2 (chloroplast) [Eucalyptus diversifolia] gi|442566916|gb|AGC57106.1| ribosomal protein S2 (chloroplast) [Eucalyptus umbra] gi|442567174|gb|AGC57361.1| ribosomal protein S2 (chloroplast) [Eucalyptus marginata] gi|442567260|gb|AGC57446.1| ribosomal protein S2 (chloroplast) [Eucalyptus curtisii] gi|442567346|gb|AGC57531.1| ribosomal protein S2 (chloroplast) [Eucalyptus melliodora] gi|442567432|gb|AGC57616.1| ribosomal protein S2 (chloroplast) [Eucalyptus melliodora] gi|442567518|gb|AGC57701.1| ribosomal protein S2 (chloroplast) [Eucalyptus polybractea] gi|442567604|gb|AGC57786.1| ribosomal protein S2 (chloroplast) [Eucalyptus cladocalyx] gi|442567776|gb|AGC57956.1| ribosomal protein S2 (chloroplast) [Eucalyptus nitens] gi|442567862|gb|AGC58041.1| ribosomal protein S2 (chloroplast) [Eucalyptus aromaphloia] gi|442568206|gb|AGC58381.1| ribosomal protein S2 (chloroplast) [Eucalyptus spathulata] gi|442568292|gb|AGC58466.1| ribosomal protein S2 (chloroplast) [Eucalyptus torquata] gi|442568378|gb|AGC58551.1| ribosomal protein S2 (chloroplast) [Eucalyptus diversicolor] gi|442568464|gb|AGC58636.1| ribosomal protein S2 (chloroplast) [Eucalyptus salmonophloia] gi|442568550|gb|AGC58721.1| ribosomal protein S2 (chloroplast) [Eucalyptus microcorys] gi|442568636|gb|AGC58806.1| ribosomal protein S2 (chloroplast) [Eucalyptus guilfoylei] gi|442569410|gb|AGC59571.1| ribosomal protein S2 (chloroplast) [Stockwellia quadrifida] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 236 >ref|NP_054921.1| ribosomal protein S2 [Spinacia oleracea] gi|133916|sp|P08242.1|RR2_SPIOL RecName: Full=30S ribosomal protein S2, chloroplastic gi|7636094|emb|CAB88714.1| ribosomal protein S2 [Spinacia oleracea] Length = 236 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNC+PDLADISIPANDDAIASIRLILTKLVF+ICEGRSSYIRNP Sbjct: 182 TLGIPTICLIDTNCNPDLADISIPANDDAIASIRLILTKLVFAICEGRSSYIRNP 236 >gb|AFU95293.1| Rps2, partial (chloroplast) [Trigonia sp. CCD-2012] Length = 243 Score = 110 bits (275), Expect = 2e-22 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILTKLVFSICEGRSSYIRNP 166 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLIL KLVF+ICEGRSSYIRNP Sbjct: 189 TLGIPTICLIDTNCDPDLADISIPANDDAIASIRLILNKLVFAICEGRSSYIRNP 243