BLASTX nr result
ID: Achyranthes22_contig00056796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00056796 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440775.1| hypothetical protein CICLE_v10018601mg [Citr... 56 4e-06 >ref|XP_006440775.1| hypothetical protein CICLE_v10018601mg [Citrus clementina] gi|557543037|gb|ESR54015.1| hypothetical protein CICLE_v10018601mg [Citrus clementina] Length = 1114 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 3/68 (4%) Frame = +3 Query: 189 MSAKLVYSLSYDKQNLKKQNGCMKGLLHFFDPHHFI---NKTHRRLPLPQAPDENKLQER 359 M+AKL++SL+ D Q+L+KQ GCM G+ FD HH + TH+RLP + +N ER Sbjct: 1 MAAKLLHSLADDNQDLQKQIGCMNGIFQLFDRHHVLTGRRLTHKRLPPGTSHFQNGGLER 60 Query: 360 TLNSVSKK 383 N+V+ + Sbjct: 61 EFNNVNHR 68