BLASTX nr result
ID: Achyranthes22_contig00056540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00056540 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25996.1| hypothetical protein PRUPE_ppa023750mg, partial [... 55 7e-06 >gb|EMJ25996.1| hypothetical protein PRUPE_ppa023750mg, partial [Prunus persica] Length = 404 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +3 Query: 3 RDEESCKSAVSVIHEEFNLQSQEIERQLKPLLDLES 110 RDEESC SA+S+I EE +LQS E+ER+LKPLLDLE+ Sbjct: 344 RDEESCNSALSMILEEISLQSNEVERRLKPLLDLET 379