BLASTX nr result
ID: Achyranthes22_contig00055895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00055895 (268 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517199.1| mitogen activated protein kinase kinase kina... 63 5e-08 gb|EXB55004.1| Mitogen-activated protein kinase kinase kinase 3 ... 59 5e-07 gb|EOY05598.1| NPK1-related protein kinase 3 [Theobroma cacao] 59 7e-07 ref|XP_006419860.1| hypothetical protein CICLE_v10004485mg [Citr... 58 1e-06 ref|XP_006419859.1| hypothetical protein CICLE_v10004485mg [Citr... 58 1e-06 ref|XP_002311605.2| hypothetical protein POPTR_0008s14880g [Popu... 55 7e-06 ref|XP_006379822.1| hypothetical protein POPTR_0008s14880g [Popu... 55 7e-06 ref|XP_002315791.1| Mitogen-activated protein kinase kinase kina... 55 7e-06 >ref|XP_002517199.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, putative [Ricinus communis] gi|223543834|gb|EEF45362.1| mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, putative [Ricinus communis] Length = 653 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/46 (73%), Positives = 40/46 (86%), Gaps = 3/46 (6%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTADDGGF---IDKIGSSIRKSRIGLFA 23 MQ+LFGSVRRSLVF+S T+ DDGGF ++KIGSSIRKSRIGLF+ Sbjct: 1 MQDLFGSVRRSLVFKS--TSGDDGGFTGFVEKIGSSIRKSRIGLFS 44 >gb|EXB55004.1| Mitogen-activated protein kinase kinase kinase 3 [Morus notabilis] Length = 695 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 6/49 (12%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTADD------GGFIDKIGSSIRKSRIGLFA 23 MQ+L GSVRRSLVFR+S D GGF++KIGSSIRKSRIGLF+ Sbjct: 1 MQDLIGSVRRSLVFRTSAQGGGDDGGGGFGGFVEKIGSSIRKSRIGLFS 49 >gb|EOY05598.1| NPK1-related protein kinase 3 [Theobroma cacao] Length = 677 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTADD-----GGFIDKIGSSIRKSRIGLFA 23 MQ+ GSVRRSLVFRSS T+ DD GGF++KIG+SIR SRIGLFA Sbjct: 1 MQDFVGSVRRSLVFRSS-TSGDDVGGGLGGFVEKIGASIRSSRIGLFA 47 >ref|XP_006419860.1| hypothetical protein CICLE_v10004485mg [Citrus clementina] gi|557521733|gb|ESR33100.1| hypothetical protein CICLE_v10004485mg [Citrus clementina] Length = 668 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTADDGG-----FIDKIGSSIRKSRIGLFA 23 MQ++ GSVRRSLVFRS T+ DDGG ++KIGSSIRKSRIGLF+ Sbjct: 1 MQDILGSVRRSLVFRS--TSGDDGGGGISGLVEKIGSSIRKSRIGLFS 46 >ref|XP_006419859.1| hypothetical protein CICLE_v10004485mg [Citrus clementina] gi|557521732|gb|ESR33099.1| hypothetical protein CICLE_v10004485mg [Citrus clementina] Length = 653 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTADDGG-----FIDKIGSSIRKSRIGLFA 23 MQ++ GSVRRSLVFRS T+ DDGG ++KIGSSIRKSRIGLF+ Sbjct: 1 MQDILGSVRRSLVFRS--TSGDDGGGGISGLVEKIGSSIRKSRIGLFS 46 >ref|XP_002311605.2| hypothetical protein POPTR_0008s14880g [Populus trichocarpa] gi|550333100|gb|EEE88972.2| hypothetical protein POPTR_0008s14880g [Populus trichocarpa] Length = 707 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTA--DDGGF---IDKIGSSIRKSRIGLFA 23 MQ++FGSVRRSLVF+S+ +DGGF ++KIGSSIR SRIGLFA Sbjct: 1 MQDIFGSVRRSLVFKSTSGGGGGEDGGFSGFVEKIGSSIRTSRIGLFA 48 >ref|XP_006379822.1| hypothetical protein POPTR_0008s14880g [Populus trichocarpa] gi|550333099|gb|ERP57619.1| hypothetical protein POPTR_0008s14880g [Populus trichocarpa] Length = 706 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTA--DDGGF---IDKIGSSIRKSRIGLFA 23 MQ++FGSVRRSLVF+S+ +DGGF ++KIGSSIR SRIGLFA Sbjct: 1 MQDIFGSVRRSLVFKSTSGGGGGEDGGFSGFVEKIGSSIRTSRIGLFA 48 >ref|XP_002315791.1| Mitogen-activated protein kinase kinase kinase 3 [Populus trichocarpa] gi|222864831|gb|EEF01962.1| Mitogen-activated protein kinase kinase kinase 3 [Populus trichocarpa] Length = 680 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/48 (62%), Positives = 39/48 (81%), Gaps = 5/48 (10%) Frame = -1 Query: 151 MQELFGSVRRSLVFRSSPTTA--DDG---GFIDKIGSSIRKSRIGLFA 23 MQ++FGSVRRSLVF+S+ +DG GF+++IGSSIRKSRIGLF+ Sbjct: 1 MQDIFGSVRRSLVFKSTSGGGGGEDGAFSGFVERIGSSIRKSRIGLFS 48