BLASTX nr result
ID: Achyranthes22_contig00053688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00053688 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40862.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002266049.1| PREDICTED: uncharacterized protein LOC100245... 63 5e-08 ref|XP_006467911.1| PREDICTED: myb-related protein 3R-1-like [Ci... 58 1e-06 ref|XP_006449197.1| hypothetical protein CICLE_v10015729mg [Citr... 57 2e-06 >emb|CBI40862.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 3/84 (3%) Frame = -1 Query: 387 IARLCVPLYDEAQLIDPNFEQYPTNIPTFDAQN---LDHWQSNGLSIPEGLVNIIQPNTS 217 +A + +E+Q+++PN EQ+P+NI F +QN + WQSNGL + +S Sbjct: 168 LATSLISFSNESQVMEPNAEQFPSNITDFSSQNSQLISDWQSNGLPSDLSEEYYVPHPSS 227 Query: 216 CEYYGSHQVFMDPSLSSNPTFQSN 145 YYGS Q MDPS S N FQSN Sbjct: 228 VGYYGSEQTIMDPS-SDNSVFQSN 250 >ref|XP_002266049.1| PREDICTED: uncharacterized protein LOC100245492 [Vitis vinifera] Length = 362 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 3/75 (4%) Frame = -1 Query: 360 DEAQLIDPNFEQYPTNIPTFDAQN---LDHWQSNGLSIPEGLVNIIQPNTSCEYYGSHQV 190 +E+Q+++PN EQ+P+NI F +QN + WQSNGL + +S YYGS Q Sbjct: 229 NESQVMEPNAEQFPSNITDFSSQNSQLISDWQSNGLPSDLSEEYYVPHPSSVGYYGSEQT 288 Query: 189 FMDPSLSSNPTFQSN 145 MDPS S N FQSN Sbjct: 289 IMDPS-SDNSVFQSN 302 >ref|XP_006467911.1| PREDICTED: myb-related protein 3R-1-like [Citrus sinensis] Length = 360 Score = 58.2 bits (139), Expect = 1e-06 Identities = 38/82 (46%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = -1 Query: 360 DEAQLIDPNFEQYPTNIPTFDAQNL--DHWQSNGLSIPEGLVNIIQP-NTSCEYYGSHQV 190 D+AQL++ N EQ+PTN F QN WQSNG+ P L P S YYGS Q Sbjct: 232 DQAQLMNSNVEQFPTNFTNFSNQNCQQSEWQSNGM--PSNLTEDYVPIPPSYSYYGSDQT 289 Query: 189 FMDPSLSSNPTFQSNISGHQSF 124 MDPS S F SN + +QSF Sbjct: 290 VMDPS-SETSNFHSN-NSNQSF 309 >ref|XP_006449197.1| hypothetical protein CICLE_v10015729mg [Citrus clementina] gi|557551808|gb|ESR62437.1| hypothetical protein CICLE_v10015729mg [Citrus clementina] Length = 359 Score = 57.4 bits (137), Expect = 2e-06 Identities = 38/82 (46%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = -1 Query: 360 DEAQLIDPNFEQYPTNIPTFDAQNL--DHWQSNGLSIPEGLVNIIQP-NTSCEYYGSHQV 190 D+AQL++ N EQ+PTN F QN WQSNG+ P L P S YYGS Q Sbjct: 231 DQAQLMNSNVEQFPTNFTNFSNQNCQQSEWQSNGM--PSTLTEDYVPIPPSYSYYGSDQT 288 Query: 189 FMDPSLSSNPTFQSNISGHQSF 124 MDPS S F SN + +QSF Sbjct: 289 VMDPS-SETSNFHSN-NSNQSF 308