BLASTX nr result
ID: Achyranthes22_contig00053638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00053638 (230 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841826.1| hypothetical protein AMTR_s00003p00269970 [A... 55 1e-05 >ref|XP_006841826.1| hypothetical protein AMTR_s00003p00269970 [Amborella trichopoda] gi|548843847|gb|ERN03501.1| hypothetical protein AMTR_s00003p00269970 [Amborella trichopoda] Length = 660 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/69 (39%), Positives = 42/69 (60%) Frame = -2 Query: 229 PGFKANIHQVYNQRRKYRKVEMAERSPLQFCLDLVAKSEYVGFTKYDSEDKLSHVFFAHP 50 P KA VYN + K R+ + RSP+Q LD +A ++ + + D E +L+H+FFAHP Sbjct: 161 PNLKAISMDVYNIKGKIRRENRSGRSPIQALLDELAHCGFLYYFQCDEEGQLTHLFFAHP 220 Query: 49 FSIRLLRTY 23 S+ L ++Y Sbjct: 221 ISVVLSKSY 229