BLASTX nr result
ID: Achyranthes22_contig00053117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00053117 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372828.1| hypothetical protein POPTR_0017s05450g [Popu... 61 2e-07 ref|XP_002327997.1| GRAS family transcription factor [Populus tr... 61 2e-07 ref|XP_002309782.1| hypothetical protein POPTR_0007s01650g [Popu... 59 9e-07 >ref|XP_006372828.1| hypothetical protein POPTR_0017s05450g [Populus trichocarpa] gi|550319476|gb|ERP50625.1| hypothetical protein POPTR_0017s05450g [Populus trichocarpa] Length = 441 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 KASWDLGLPQRDHEVGIHLKWRDEPVVWASAWKP 104 KA W L LPQ DHE GI+L W++EPVVWASAWKP Sbjct: 408 KAGWALVLPQGDHESGIYLTWKEEPVVWASAWKP 441 >ref|XP_002327997.1| GRAS family transcription factor [Populus trichocarpa] Length = 411 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 KASWDLGLPQRDHEVGIHLKWRDEPVVWASAWKP 104 KA W L LPQ DHE GI+L W++EPVVWASAWKP Sbjct: 378 KAGWALVLPQGDHESGIYLTWKEEPVVWASAWKP 411 >ref|XP_002309782.1| hypothetical protein POPTR_0007s01650g [Populus trichocarpa] gi|222852685|gb|EEE90232.1| hypothetical protein POPTR_0007s01650g [Populus trichocarpa] Length = 411 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +3 Query: 3 KASWDLGLPQRDHEVGIHLKWRDEPVVWASAWKP 104 +A W L LPQ DH+ GI+L W++EPVVWASAWKP Sbjct: 378 RAGWALVLPQGDHDSGIYLTWKEEPVVWASAWKP 411