BLASTX nr result
ID: Achyranthes22_contig00052944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00052944 (736 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ22362.1| hypothetical protein PRUPE_ppa020529mg, partial [... 39 7e-06 gb|ESW14675.1| hypothetical protein PHAVU_007G007800g [Phaseolus... 39 9e-06 >gb|EMJ22362.1| hypothetical protein PRUPE_ppa020529mg, partial [Prunus persica] Length = 433 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 85 QLSPDNLPPGIKSLLSEAIGTVAKLAVL 2 QL+PDNL P +K+LLS+ +G VAKLA++ Sbjct: 42 QLAPDNLNPELKALLSDDVGDVAKLAIV 69 Score = 37.7 bits (86), Expect(2) = 7e-06 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -3 Query: 239 RSLFACKSIQAGDCLLKVPF 180 RSLFA K+I+AGDC+LKVPF Sbjct: 20 RSLFASKAIRAGDCILKVPF 39 >gb|ESW14675.1| hypothetical protein PHAVU_007G007800g [Phaseolus vulgaris] Length = 449 Score = 39.3 bits (90), Expect(2) = 9e-06 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -1 Query: 85 QLSPDNLPPGIKSLLSEAIGTVAKLAVL 2 Q++ DNLPP IKSL+ E +G +AKLA++ Sbjct: 81 QITADNLPPEIKSLIGEQVGDIAKLAIV 108 Score = 37.0 bits (84), Expect(2) = 9e-06 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -3 Query: 269 TSFFLRVCIY-RSLFACKSIQAGDCLLKVPF 180 +S F+ Y RSLFA K+IQ GDC+LKVP+ Sbjct: 48 SSLFIGKSSYGRSLFASKTIQTGDCILKVPY 78