BLASTX nr result
ID: Achyranthes22_contig00050448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00050448 (902 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF75885.1| glucosyltransferase [Dianthus caryophyllus] 57 6e-07 dbj|BAF75883.1| glucosyltransferase [Dianthus caryophyllus] 55 3e-06 >dbj|BAF75885.1| glucosyltransferase [Dianthus caryophyllus] Length = 452 Score = 57.0 bits (136), Expect(2) = 6e-07 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = -1 Query: 800 LNKSFAVPF*DSLYRTLTDTS-KDKEPVACLILDPSWNFVETVADEYNLPRLALR-GGLF 627 LN + PF D + + + D S +D+E VACLI+DP W+F VA+ +NLPR+ALR GGL Sbjct: 88 LNANCMEPFRDCISQIMKDASAEDQERVACLIIDPVWSFPGDVANSFNLPRIALRTGGLS 147 Query: 626 GY 621 Y Sbjct: 148 TY 149 Score = 23.9 bits (50), Expect(2) = 6e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 601 SLPFLRQKGYF 569 SLP LR+KGYF Sbjct: 154 SLPLLREKGYF 164 >dbj|BAF75883.1| glucosyltransferase [Dianthus caryophyllus] Length = 452 Score = 55.5 bits (132), Expect(2) = 3e-06 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 800 LNKSFAVPF*DSLYRTLTDT-SKDKEPVACLILDPSWNFVETVADEYNLPRLALRGG 633 +N + + PF D + + + + + D+E VACLI+DP W F TVA+ +NLPR+ALR G Sbjct: 88 MNDNCSEPFKDCISQIMKEAGAADQERVACLIMDPMWRFAGTVANSFNLPRIALRTG 144 Score = 22.7 bits (47), Expect(2) = 3e-06 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 601 SLPFLRQKGYFYL 563 SLP LR++GYF L Sbjct: 154 SLPLLREEGYFPL 166