BLASTX nr result
ID: Achyranthes22_contig00050410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00050410 (454 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164722.1| PREDICTED: uncharacterized LOC101205845, par... 55 7e-06 ref|XP_004149136.1| PREDICTED: uncharacterized protein LOC101205... 55 7e-06 >ref|XP_004164722.1| PREDICTED: uncharacterized LOC101205845, partial [Cucumis sativus] Length = 402 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 234 WLKKWFMYPNVVCSYLYIFLWDKDLGVDYFDP 139 W K F++P++V Y YIFLWD+DLGVDYFDP Sbjct: 159 WFAKRFLHPDIVAEYNYIFLWDEDLGVDYFDP 190 >ref|XP_004149136.1| PREDICTED: uncharacterized protein LOC101205845 [Cucumis sativus] Length = 414 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -2 Query: 234 WLKKWFMYPNVVCSYLYIFLWDKDLGVDYFDP 139 W K F++P++V Y YIFLWD+DLGVDYFDP Sbjct: 103 WFAKRFLHPDIVAEYNYIFLWDEDLGVDYFDP 134