BLASTX nr result
ID: Achyranthes22_contig00050208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00050208 (217 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343908.1| PREDICTED: disease resistance response prote... 57 3e-06 ref|XP_006343909.1| PREDICTED: disease resistance response prote... 56 4e-06 ref|XP_004245554.1| PREDICTED: disease resistance response prote... 56 4e-06 emb|CBI34419.3| unnamed protein product [Vitis vinifera] 56 4e-06 ref|XP_002272144.1| PREDICTED: disease resistance response prote... 56 4e-06 gb|EXC10833.1| hypothetical protein L484_003077 [Morus notabilis] 56 6e-06 gb|EXC10832.1| hypothetical protein L484_003076 [Morus notabilis] 56 6e-06 ref|XP_002509891.1| Disease resistance response protein, putativ... 56 6e-06 gb|EPS69503.1| hypothetical protein M569_05266, partial [Genlise... 55 7e-06 >ref|XP_006343908.1| PREDICTED: disease resistance response protein 206-like [Solanum tuberosum] Length = 189 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD+++G+ YFRLRV +KLYECW Sbjct: 159 MARGIATIMTDSFEGDVYFRLRVDIKLYECW 189 >ref|XP_006343909.1| PREDICTED: disease resistance response protein 206-like [Solanum tuberosum] Length = 189 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 M RG+AT TD ++G+ YFRLRVHVKLYECW Sbjct: 156 MTRGIATLSTDAFEGSVYFRLRVHVKLYECW 186 >ref|XP_004245554.1| PREDICTED: disease resistance response protein 206-like [Solanum lycopersicum] Length = 189 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 M RG+AT TD ++G+ YFRLRVHVKLYECW Sbjct: 156 MTRGIATLSTDAFEGSVYFRLRVHVKLYECW 186 >emb|CBI34419.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD ++G YFRLRV VKLYECW Sbjct: 209 MARGIATLMTDAFEGEVYFRLRVDVKLYECW 239 >ref|XP_002272144.1| PREDICTED: disease resistance response protein 206-like [Vitis vinifera] Length = 192 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD ++G YFRLRV VKLYECW Sbjct: 162 MARGIATLMTDAFEGEVYFRLRVDVKLYECW 192 >gb|EXC10833.1| hypothetical protein L484_003077 [Morus notabilis] Length = 189 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD ++G YFRLRV +KLYECW Sbjct: 159 MARGIATLMTDAFEGEVYFRLRVDIKLYECW 189 >gb|EXC10832.1| hypothetical protein L484_003076 [Morus notabilis] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD ++G YFRLRV +KLYECW Sbjct: 161 MARGIATLMTDAFEGEVYFRLRVDIKLYECW 191 >ref|XP_002509891.1| Disease resistance response protein, putative [Ricinus communis] gi|223549790|gb|EEF51278.1| Disease resistance response protein, putative [Ricinus communis] Length = 186 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARG+AT MTD ++G YFRLRV +KLYECW Sbjct: 156 MARGIATLMTDAFEGEVYFRLRVDIKLYECW 186 >gb|EPS69503.1| hypothetical protein M569_05266, partial [Genlisea aurea] Length = 166 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 217 MARGVATFMTDTYQGNAYFRLRVHVKLYECW 125 MARGVAT MTD +G+ YFRLRV VKLYECW Sbjct: 136 MARGVATLMTDAIEGDVYFRLRVDVKLYECW 166