BLASTX nr result
ID: Achyranthes22_contig00050124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00050124 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003527792.1| PREDICTED: G-type lectin S-receptor-like ser... 58 1e-06 ref|XP_003523689.1| PREDICTED: G-type lectin S-receptor-like ser... 57 3e-06 ref|XP_002309629.1| hypothetical protein POPTR_0006s27070g [Popu... 56 4e-06 >ref|XP_003527792.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5-like [Glycine max] Length = 817 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 159 MAYGGHKYHIRKKEVLDSPLQTSEYGSFVSSLPSTPVRYSYKSLLEATNNFSV 1 + +GG +YH RK+ + +SP + SE +F+ +L P+RYSYK L ATNNFSV Sbjct: 445 LVFGGVRYHRRKQRLPESPREGSEEDNFLENLTGMPIRYSYKDLEAATNNFSV 497 >ref|XP_003523689.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5-like [Glycine max] Length = 816 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -3 Query: 159 MAYGGHKYHIRKKEVLDSPLQTSEYGSFVSSLPSTPVRYSYKSLLEATNNFSV 1 + +GG +YH RK+ + +SP SE +F+ +L P+RYSYK L ATNNFSV Sbjct: 443 LVFGGVRYHRRKQRLPESPRDGSEEDNFLENLTGMPIRYSYKDLETATNNFSV 495 >ref|XP_002309629.1| hypothetical protein POPTR_0006s27070g [Populus trichocarpa] gi|222855605|gb|EEE93152.1| hypothetical protein POPTR_0006s27070g [Populus trichocarpa] Length = 816 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/53 (47%), Positives = 37/53 (69%) Frame = -3 Query: 159 MAYGGHKYHIRKKEVLDSPLQTSEYGSFVSSLPSTPVRYSYKSLLEATNNFSV 1 + Y +YH +KK++L+SP TSE +F+ +L P+R+SY+ L ATNNFSV Sbjct: 444 LLYMAFRYHRKKKKMLESPPNTSEDDNFLETLSGMPIRFSYRDLQTATNNFSV 496