BLASTX nr result
ID: Achyranthes22_contig00049701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049701 (449 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250379.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-16 ref|XP_006351208.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 gb|EXB53573.1| hypothetical protein L484_009313 [Morus notabilis] 85 9e-15 ref|XP_002308773.2| hypothetical protein POPTR_0006s00960g [Popu... 85 9e-15 gb|EMJ17708.1| hypothetical protein PRUPE_ppa025580mg, partial [... 84 2e-14 ref|XP_006481381.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_006429784.1| hypothetical protein CICLE_v10011066mg [Citr... 83 4e-14 gb|EOX93207.1| Tetratricopeptide repeat (TPR)-like superfamily p... 83 4e-14 ref|NP_188854.1| pentatricopeptide repeat-containing protein [Ar... 80 2e-13 ref|XP_006406206.1| hypothetical protein EUTSA_v10020073mg [Eutr... 80 2e-13 ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_002883344.1| pentatricopeptide repeat-containing protein ... 79 6e-13 ref|XP_003618091.1| Pentatricopeptide repeat-containing protein ... 75 7e-12 ref|XP_002265138.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 emb|CAN67593.1| hypothetical protein VITISV_000699 [Vitis vinifera] 75 7e-12 ref|XP_006296991.1| hypothetical protein CARUB_v10012985mg [Caps... 74 2e-11 ref|XP_003603719.1| Wall-associated receptor kinase-like protein... 71 1e-10 ref|XP_006576131.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 gb|ESW14542.1| hypothetical protein PHAVU_008G290100g [Phaseolus... 65 1e-08 >ref|XP_004250379.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Solanum lycopersicum] Length = 835 Score = 89.0 bits (219), Expect = 6e-16 Identities = 45/79 (56%), Positives = 56/79 (70%), Gaps = 4/79 (5%) Frame = +1 Query: 223 STSLISLKDPTFDSL----NETKIPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKS 390 S SL P F SL + + + K +IRFRLS+LCR GQPH+A Q+FDT+P+P S Sbjct: 24 SPSLSLTHLPNFSSLPLTDQQCTLTDSKPRTIRFRLSELCRQGQPHLARQLFDTIPQP-S 82 Query: 391 TVLWNTIIIGFICNNLPFE 447 TVLWNTIIIGF+CNN+P E Sbjct: 83 TVLWNTIIIGFVCNNMPHE 101 >ref|XP_006351208.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like, partial [Solanum tuberosum] Length = 831 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/79 (55%), Positives = 56/79 (70%), Gaps = 4/79 (5%) Frame = +1 Query: 223 STSLISLKDPTFDSL----NETKIPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKS 390 S SL P + SL + + + K +IRFRLS+LCR GQPH+A Q+FDT+P+P S Sbjct: 22 SPSLSLTHLPNYSSLPLTDQQCTLADSKPRTIRFRLSELCRQGQPHLARQLFDTIPQP-S 80 Query: 391 TVLWNTIIIGFICNNLPFE 447 TVLWNTIIIGF+CNN+P E Sbjct: 81 TVLWNTIIIGFVCNNMPHE 99 >gb|EXB53573.1| hypothetical protein L484_009313 [Morus notabilis] Length = 820 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/54 (68%), Positives = 47/54 (87%) Frame = +1 Query: 280 IPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLP 441 +P K P+IR RLS+LC++G+PH+A Q+FDTLP+P +TVLWNTIIIGFICNN P Sbjct: 34 LPKPKTPTIRSRLSKLCQEGKPHLARQLFDTLPRP-TTVLWNTIIIGFICNNFP 86 >ref|XP_002308773.2| hypothetical protein POPTR_0006s00960g [Populus trichocarpa] gi|550335185|gb|EEE92296.2| hypothetical protein POPTR_0006s00960g [Populus trichocarpa] Length = 820 Score = 85.1 bits (209), Expect = 9e-15 Identities = 48/87 (55%), Positives = 60/87 (68%), Gaps = 12/87 (13%) Frame = +1 Query: 223 STSL-ISLKDPTFDSLNETK-----------IPNQKNPSIRFRLSQLCRDGQPHIAHQVF 366 S+SL I L P+ D N+T+ P+ K PSIR RLS+LC++GQPHIA Q+F Sbjct: 6 SSSLPIPLSTPSHDPSNKTQKTSLFRISPPPSPSLKTPSIRSRLSKLCQEGQPHIALQLF 65 Query: 367 DTLPKPKSTVLWNTIIIGFICNNLPFE 447 DT P+P +TV+ NTIIIGFICNNLP E Sbjct: 66 DTFPRP-TTVICNTIIIGFICNNLPLE 91 >gb|EMJ17708.1| hypothetical protein PRUPE_ppa025580mg, partial [Prunus persica] Length = 804 Score = 84.0 bits (206), Expect = 2e-14 Identities = 42/75 (56%), Positives = 53/75 (70%) Frame = +1 Query: 223 STSLISLKDPTFDSLNETKIPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLW 402 ST P S + +P K P+IR RLS+LC++GQP +A Q+FDTLP+P +TVLW Sbjct: 16 STQTSIANPPENLSSSALPLPKLKTPTIRSRLSKLCQEGQPLLARQLFDTLPRP-TTVLW 74 Query: 403 NTIIIGFICNNLPFE 447 NTIIIGFICNN+P E Sbjct: 75 NTIIIGFICNNMPNE 89 >ref|XP_006481381.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Citrus sinensis] Length = 833 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/56 (60%), Positives = 49/56 (87%) Frame = +1 Query: 280 IPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 IP K P+IR RLS++C++G+PH+A Q+FD++ +P +TV+WNTIIIGF+CNNLP+E Sbjct: 34 IPKLKTPTIRSRLSKICQEGRPHLARQLFDSITRP-TTVIWNTIIIGFVCNNLPYE 88 >ref|XP_006429784.1| hypothetical protein CICLE_v10011066mg [Citrus clementina] gi|557531841|gb|ESR43024.1| hypothetical protein CICLE_v10011066mg [Citrus clementina] Length = 833 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/56 (60%), Positives = 49/56 (87%) Frame = +1 Query: 280 IPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 IP K P+IR RLS++C++G+PH+A Q+FD++ +P +TV+WNTIIIGF+CNNLP+E Sbjct: 34 IPKLKTPTIRSRLSKICQEGRPHLARQLFDSITRP-TTVIWNTIIIGFVCNNLPYE 88 >gb|EOX93207.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 923 Score = 82.8 bits (203), Expect = 4e-14 Identities = 43/82 (52%), Positives = 55/82 (67%) Frame = +1 Query: 202 LSHNRQLSTSLISLKDPTFDSLNETKIPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPK 381 LSH+ Q ++IS P P + P+IR RLSQLC+ G PH+A Q+FDT+ + Sbjct: 127 LSHSSQ---TIISSPPPN---------PTLRTPTIRSRLSQLCQQGHPHLARQIFDTIAE 174 Query: 382 PKSTVLWNTIIIGFICNNLPFE 447 PK TVLWNTI+IGFICNN+P E Sbjct: 175 PK-TVLWNTIVIGFICNNMPQE 195 >ref|NP_188854.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273371|sp|Q9LIE7.1|PP246_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g22150, chloroplastic; Flags: Precursor gi|11994734|dbj|BAB03063.1| selenium-binding protein-like [Arabidopsis thaliana] gi|110739449|dbj|BAF01634.1| hypothetical protein [Arabidopsis thaliana] gi|332643073|gb|AEE76594.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 820 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 + PSIR RLS++C+DG P +A Q+FD +PKP +TVLWNTIIIGFICNNLP E Sbjct: 38 QTPSIRSRLSKICQDGNPQLARQLFDAIPKP-TTVLWNTIIIGFICNNLPHE 88 >ref|XP_006406206.1| hypothetical protein EUTSA_v10020073mg [Eutrema salsugineum] gi|557107352|gb|ESQ47659.1| hypothetical protein EUTSA_v10020073mg [Eutrema salsugineum] Length = 825 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 + PSIR RLS++C+DG P +A Q+FD +PKP +TVLWNTIIIGFICNNLP E Sbjct: 38 QTPSIRSRLSRICQDGNPQLARQLFDAIPKP-TTVLWNTIIIGFICNNLPHE 88 >ref|XP_004167803.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 817 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = +1 Query: 274 TKIPNQKNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 T N K P+IR+RLS+LC++GQ H+A Q+FD LP+P STVLWNTIIIG +CNN P E Sbjct: 21 THSTNPKIPTIRYRLSRLCQEGQLHLARQLFDALPRP-STVLWNTIIIGLVCNNFPDE 77 >ref|XP_002883344.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329184|gb|EFH59603.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 824 Score = 79.0 bits (193), Expect = 6e-13 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 + PSIR RLS++C++G P +A Q+FD +PKP +TVLWNTIIIGFICNNLP E Sbjct: 38 QTPSIRSRLSKICQEGNPQLARQLFDAIPKP-TTVLWNTIIIGFICNNLPHE 88 >ref|XP_003618091.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519426|gb|AET01050.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 828 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 12/68 (17%) Frame = +1 Query: 280 IPNQK------------NPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGF 423 +PNQK + SIR RLS+LCR+GQPH+A + D+LP+P STV+WN++IIGF Sbjct: 32 LPNQKQKQKQKQWNKAISTSIRSRLSKLCREGQPHLALHLLDSLPRP-STVVWNSVIIGF 90 Query: 424 ICNNLPFE 447 ICNNLP + Sbjct: 91 ICNNLPHQ 98 >ref|XP_002265138.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Vitis vinifera] Length = 825 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 K P+IR RLS LCR G PH A +FD++P+P +TVLWNTIIIGFICNN+P + Sbjct: 36 KPPTIRSRLSHLCRQGHPHQALHLFDSIPRP-TTVLWNTIIIGFICNNMPID 86 >emb|CAN67593.1| hypothetical protein VITISV_000699 [Vitis vinifera] Length = 825 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 K P+IR RLS LCR G PH A +FD++P+P +TVLWNTIIIGFICNN+P + Sbjct: 36 KPPTIRSRLSHLCRQGHPHQALHLFDSIPRP-TTVLWNTIIIGFICNNMPID 86 >ref|XP_006296991.1| hypothetical protein CARUB_v10012985mg [Capsella rubella] gi|565478704|ref|XP_006296992.1| hypothetical protein CARUB_v10012985mg [Capsella rubella] gi|482565700|gb|EOA29889.1| hypothetical protein CARUB_v10012985mg [Capsella rubella] gi|482565701|gb|EOA29890.1| hypothetical protein CARUB_v10012985mg [Capsella rubella] Length = 824 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +1 Query: 292 KNPSIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 + PSIR RLS++C+DG P +A Q+FD +PKP +TVLWNTIIIGFICN++ E Sbjct: 38 QTPSIRSRLSKICQDGNPQLARQLFDAIPKP-TTVLWNTIIIGFICNSMSQE 88 >ref|XP_003603719.1| Wall-associated receptor kinase-like protein [Medicago truncatula] gi|355492767|gb|AES73970.1| Wall-associated receptor kinase-like protein [Medicago truncatula] Length = 350 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = +1 Query: 301 SIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 +IR RLS+LCR+GQPH+A + D+LP+P STV+WN++I GFICNNLP + Sbjct: 254 NIRSRLSKLCREGQPHLALHLVDSLPRP-STVVWNSVITGFICNNLPHQ 301 >ref|XP_006576131.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic [Glycine max] Length = 752 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = +1 Query: 301 SIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 SIR RLS+LC+ GQPH+A + DTLP+ S V WNT+IIGFICN++P E Sbjct: 27 SIRSRLSKLCQQGQPHLARHLLDTLPRASSAV-WNTVIIGFICNHMPLE 74 >ref|XP_004146067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22150, chloroplastic-like [Cucumis sativus] Length = 793 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 316 LSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 L +LC++GQ H+A Q+FD LP+P STVLWNTIIIG +CNN P E Sbjct: 11 LCRLCQEGQLHLARQLFDALPRP-STVLWNTIIIGLVCNNFPDE 53 >gb|ESW14542.1| hypothetical protein PHAVU_008G290100g [Phaseolus vulgaris] Length = 802 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/49 (57%), Positives = 38/49 (77%) Frame = +1 Query: 301 SIRFRLSQLCRDGQPHIAHQVFDTLPKPKSTVLWNTIIIGFICNNLPFE 447 +IR RLS+LC+ GQP +A + D+LP+ ST +WNT+IIGFICN +P E Sbjct: 26 TIRTRLSKLCQQGQPQLARHLLDSLPRA-STAVWNTVIIGFICNKMPLE 73