BLASTX nr result
ID: Achyranthes22_contig00049607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049607 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|A... 57 2e-06 ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago t... 57 2e-06 >ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|AES60146.1| TNP1 [Medicago truncatula] Length = 316 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = -2 Query: 395 GITTCRLALSRPTYRIVATGQVHNLGTSSIHTLPIPSGHVKVMVQDAFEEYTSLLVPIDD 216 GI++ + LS P R+VA G+++N + +H +P G+VKV + A E L +P+++ Sbjct: 53 GISSIEIYLSSPCRRLVAHGKLYNTSSDVLHNKKLPPGYVKVRIDVAVERKDLLPIPVEE 112 Query: 215 -EAVVICEAKSTFVLWPIELVIL 150 + + + EA TFV W + LV L Sbjct: 113 GDVLTVGEAIGTFVAWELNLVKL 135 >ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago truncatula] gi|355478926|gb|AES60129.1| Ubiquitin-like-specific protease [Medicago truncatula] Length = 420 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = -2 Query: 395 GITTCRLALSRPTYRIVATGQVHNLGTSSIHTLPIPSGHVKVMVQDAFEEYTSLLVPIDD 216 GI++ + LS P R+VA G+++N + +H +P G+VKV + A E L +P+++ Sbjct: 69 GISSIEIYLSSPCRRLVAHGKLYNTSSDVLHNKKLPPGYVKVRIDVAVERKDLLPIPVEE 128 Query: 215 -EAVVICEAKSTFVLWPIELVIL 150 + + + EA TFV W + LV L Sbjct: 129 GDVLTVGEAIGTFVAWELNLVKL 151