BLASTX nr result
ID: Achyranthes22_contig00049544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049544 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002332227.1| predicted protein [Populus trichocarpa] 60 4e-07 ref|XP_002524949.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002332227.1| predicted protein [Populus trichocarpa] Length = 126 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 258 HCATCFLCAQRIFYEEKRNCPVCRRFIGKISRWF 157 HCATC++CAQRIF E + CPVCRRFIGKI + F Sbjct: 91 HCATCYVCAQRIFNSENKVCPVCRRFIGKIRKLF 124 >ref|XP_002524949.1| conserved hypothetical protein [Ricinus communis] gi|223535784|gb|EEF37446.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 258 HCATCFLCAQRIFYEEKRNCPVCRRFIGKISRWF 157 HCATC++CA+RIF E + CPVCRRFIGK+ + F Sbjct: 55 HCATCYVCARRIFDGENKVCPVCRRFIGKVRKLF 88