BLASTX nr result
ID: Achyranthes22_contig00049179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049179 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525071.1| Ribulose-1,5 bisphosphate carboxylase/oxygen... 64 3e-08 >ref|XP_002525071.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] gi|223535652|gb|EEF37318.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplast precursor, putative [Ricinus communis] Length = 456 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 4 RFAIRRRMALDLLTGEVRVLRSASTWLKNYCQSYLHQS 117 RFA+RR+MALDLLTGE+RVL+SAS WLKNYC S L Q+ Sbjct: 402 RFALRRQMALDLLTGELRVLKSASAWLKNYCTSLLQQT 439