BLASTX nr result
ID: Achyranthes22_contig00049122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049122 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY18103.1| Regulator of chromosome condensation repeat-conta... 73 3e-11 gb|EOY18100.1| Regulator of chromosome condensation repeat-conta... 73 3e-11 ref|XP_003538429.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 72 8e-11 ref|NP_191117.1| regulator of chromosome condensation repeat-con... 72 1e-10 ref|XP_006290997.1| hypothetical protein CARUB_v10017109mg [Caps... 72 1e-10 dbj|BAE98367.1| regulator of chromosome condensation-like protei... 72 1e-10 ref|XP_006403444.1| hypothetical protein EUTSA_v10010326mg [Eutr... 71 2e-10 ref|XP_006486416.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 70 2e-10 ref|XP_006486415.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 70 2e-10 ref|XP_006486413.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 70 2e-10 ref|XP_006435613.1| hypothetical protein CICLE_v10031165mg [Citr... 70 2e-10 ref|XP_006435612.1| hypothetical protein CICLE_v10031165mg [Citr... 70 2e-10 ref|XP_003552762.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 69 9e-10 ref|XP_002876312.1| regulator of chromosome condensation family ... 69 9e-10 gb|ESW35460.1| hypothetical protein PHAVU_001G236500g [Phaseolus... 67 3e-09 gb|ESW13842.1| hypothetical protein PHAVU_008G230700g [Phaseolus... 66 4e-09 ref|XP_004503178.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 65 7e-09 ref|XP_006595895.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 65 1e-08 ref|XP_006575514.1| PREDICTED: probable E3 ubiquitin-protein lig... 65 1e-08 ref|XP_006575513.1| PREDICTED: probable E3 ubiquitin-protein lig... 65 1e-08 >gb|EOY18103.1| Regulator of chromosome condensation repeat-containing protein isoform 4 [Theobroma cacao] Length = 435 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQRTPL SPV V++P S+G SW DVCGG Sbjct: 22 VFMWGYLPGALPQRTPLLSPVVVRIPASVGCSWTDVCGG 60 >gb|EOY18100.1| Regulator of chromosome condensation repeat-containing protein isoform 1 [Theobroma cacao] gi|508726204|gb|EOY18101.1| Regulator of chromosome condensation repeat-containing protein isoform 1 [Theobroma cacao] gi|508726205|gb|EOY18102.1| Regulator of chromosome condensation repeat-containing protein isoform 1 [Theobroma cacao] Length = 486 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQRTPL SPV V++P S+G SW DVCGG Sbjct: 22 VFMWGYLPGALPQRTPLLSPVVVRIPASVGCSWTDVCGG 60 >ref|XP_003538429.1| PREDICTED: ultraviolet-B receptor UVR8-like [Glycine max] Length = 480 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGALPQRTPL +PV V++PPS G SWKDVCGG Sbjct: 21 VYMWGYLPGALPQRTPLLTPVLVRVPPS-GYSWKDVCGG 58 >ref|NP_191117.1| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] gi|7076801|emb|CAB75916.1| Regulator of chromosome condensation-like protein [Arabidopsis thaliana] gi|332645883|gb|AEE79404.1| regulator of chromosome condensation repeat-containing protein [Arabidopsis thaliana] Length = 488 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGA PQR+PL SPV VK+PP++ SSWKDV GG Sbjct: 33 VYMWGYLPGASPQRSPLMSPVEVKIPPAVESSWKDVSGG 71 >ref|XP_006290997.1| hypothetical protein CARUB_v10017109mg [Capsella rubella] gi|482559704|gb|EOA23895.1| hypothetical protein CARUB_v10017109mg [Capsella rubella] Length = 488 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGA PQR+PL SPV VK+P ++GSSWKDV GG Sbjct: 33 VYMWGYLPGASPQRSPLMSPVEVKIPSAVGSSWKDVSGG 71 >dbj|BAE98367.1| regulator of chromosome condensation-like protein [Arabidopsis thaliana] Length = 488 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGA PQR+PL SPV VK+PP++ SSWKDV GG Sbjct: 33 VYMWGYLPGASPQRSPLMSPVEVKIPPAVESSWKDVSGG 71 >ref|XP_006403444.1| hypothetical protein EUTSA_v10010326mg [Eutrema salsugineum] gi|557104563|gb|ESQ44897.1| hypothetical protein EUTSA_v10010326mg [Eutrema salsugineum] Length = 486 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGA PQR+PL SPV VK+PP + SSWKDV GG Sbjct: 27 VYMWGYLPGASPQRSPLLSPVVVKIPPEVESSWKDVSGG 65 >ref|XP_006486416.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X4 [Citrus sinensis] Length = 419 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQR+P+ SP+ V+LP ++GS+W+DVCGG Sbjct: 14 VFMWGYLPGALPQRSPILSPLVVRLPLTVGSAWRDVCGG 52 >ref|XP_006486415.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X3 [Citrus sinensis] Length = 444 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQR+P+ SP+ V+LP ++GS+W+DVCGG Sbjct: 14 VFMWGYLPGALPQRSPILSPLVVRLPLTVGSAWRDVCGG 52 >ref|XP_006486413.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X1 [Citrus sinensis] Length = 477 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQR+P+ SP+ V+LP ++GS+W+DVCGG Sbjct: 14 VFMWGYLPGALPQRSPILSPLVVRLPLTVGSAWRDVCGG 52 >ref|XP_006435613.1| hypothetical protein CICLE_v10031165mg [Citrus clementina] gi|557537809|gb|ESR48853.1| hypothetical protein CICLE_v10031165mg [Citrus clementina] Length = 542 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQR+P+ SP+ V+LP ++GS+W+DVCGG Sbjct: 79 VFMWGYLPGALPQRSPILSPLVVRLPLTVGSAWRDVCGG 117 >ref|XP_006435612.1| hypothetical protein CICLE_v10031165mg [Citrus clementina] gi|557537808|gb|ESR48852.1| hypothetical protein CICLE_v10031165mg [Citrus clementina] Length = 422 Score = 70.5 bits (171), Expect = 2e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQR+P+ SP+ V+LP ++GS+W+DVCGG Sbjct: 79 VFMWGYLPGALPQRSPILSPLVVRLPLTVGSAWRDVCGG 117 >ref|XP_003552762.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform 1 [Glycine max] Length = 472 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGALPQRTPL +P+ V++PPS G WKDVCGG Sbjct: 17 VYMWGYLPGALPQRTPLLTPLLVRVPPS-GYFWKDVCGG 54 >ref|XP_002876312.1| regulator of chromosome condensation family protein [Arabidopsis lyrata subsp. lyrata] gi|297322150|gb|EFH52571.1| regulator of chromosome condensation family protein [Arabidopsis lyrata subsp. lyrata] Length = 482 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGA QR+PL SPV VK+PP++ SSWKDV GG Sbjct: 29 VYMWGYLPGASQQRSPLMSPVEVKIPPAVESSWKDVSGG 67 >gb|ESW35460.1| hypothetical protein PHAVU_001G236500g [Phaseolus vulgaris] Length = 475 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 V+MWGYLPGALPQRTPL +PV V++PPS+ SW DVCGG Sbjct: 17 VFMWGYLPGALPQRTPLLTPVLVRVPPSV-YSWGDVCGG 54 >gb|ESW13842.1| hypothetical protein PHAVU_008G230700g [Phaseolus vulgaris] Length = 447 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 +YMWGYLPGALPQRTPL +PV V+ PP SWKDVCGG Sbjct: 18 LYMWGYLPGALPQRTPLLTPVAVRFPPCC-YSWKDVCGG 55 >ref|XP_004503178.1| PREDICTED: ultraviolet-B receptor UVR8-like [Cicer arietinum] Length = 474 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 VYMWGYLPGALPQRTPL +PV V++PPS SWKDV GG Sbjct: 17 VYMWGYLPGALPQRTPLLTPVQVRVPPSC-YSWKDVSGG 54 >ref|XP_006595895.1| PREDICTED: ultraviolet-B receptor UVR8-like isoform X2 [Glycine max] Length = 478 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 +YMWGYLPGALPQRTPL +PV V++PP SW DVCGG Sbjct: 18 LYMWGYLPGALPQRTPLLTPVAVRVPP-CDYSWNDVCGG 55 >ref|XP_006575514.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform X3 [Glycine max] Length = 412 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 +YMWGYLPGALPQRTPL +PV V++PP SW DVCGG Sbjct: 18 LYMWGYLPGALPQRTPLLTPVAVRVPP-CDYSWNDVCGG 55 >ref|XP_006575513.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC1-like isoform X2 [Glycine max] Length = 429 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +1 Query: 181 VYMWGYLPGALPQRTPLQSPVTVKLPPSIGSSWKDVCGG 297 +YMWGYLPGALPQRTPL +PV V++PP SW DVCGG Sbjct: 18 LYMWGYLPGALPQRTPLLTPVAVRVPP-CDYSWNDVCGG 55