BLASTX nr result
ID: Achyranthes22_contig00049021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049021 (586 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF81250.1|AF267754_1 putative potassium channel protein Kmt1... 60 5e-07 >gb|AAF81250.1|AF267754_1 putative potassium channel protein Kmt1p [Mesembryanthemum crystallinum] Length = 439 Score = 59.7 bits (143), Expect = 5e-07 Identities = 42/123 (34%), Positives = 58/123 (47%) Frame = +3 Query: 216 EDLGVVKILLDERNDMTWKLPDYSIKQDRSICNNQLSCHKNDESFDRISIEVDEIKASQF 395 EDL VKILL+E + W D RS N L N E R + D I Sbjct: 279 EDLDTVKILLEEGHPTRWNPYD----DLRSYQNGDLQDSMNTEVGLRQTAGFDNIIPVSN 334 Query: 396 NGIVQSHRQHHNCSQIVAERSRSSNHVEHSGAPASKFNNKVRVIIHMKPKSESLENQFGK 575 I++S + Q V + SR S+ +FN+KVRV IHMK K++S+E GK Sbjct: 335 QSIIESPKYGQCQCQTVGKNSRMSHPSNDHERAILRFNDKVRVTIHMKSKNDSMEQHLGK 394 Query: 576 LIV 584 +++ Sbjct: 395 VVI 397