BLASTX nr result
ID: Achyranthes22_contig00049003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00049003 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449322.1| hypothetical protein CICLE_v10014972mg [Citr... 58 2e-06 ref|XP_006347056.1| PREDICTED: probable allantoinase 1-like [Sol... 57 2e-06 ref|XP_004232860.1| PREDICTED: probable allantoinase 1-like isof... 57 2e-06 gb|EOY28274.1| Allantoinase, putative isoform 3 [Theobroma cacao] 57 3e-06 gb|EOY28272.1| Allantoinase, putative isoform 1 [Theobroma cacao] 57 3e-06 gb|EMJ15029.1| hypothetical protein PRUPE_ppa004531mg [Prunus pe... 57 3e-06 ref|XP_006396647.1| hypothetical protein EUTSA_v10028578mg [Eutr... 56 6e-06 ref|XP_006290046.1| hypothetical protein CARUB_v10003686mg [Caps... 55 1e-05 ref|XP_002874824.1| hypothetical protein ARALYDRAFT_490140 [Arab... 55 1e-05 >ref|XP_006449322.1| hypothetical protein CICLE_v10014972mg [Citrus clementina] gi|557551933|gb|ESR62562.1| hypothetical protein CICLE_v10014972mg [Citrus clementina] Length = 507 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 SGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 S CSLLPYNHYW++SKRIVT GVISGAVEI Sbjct: 35 SECSLLPYNHYWLTSKRIVTPKGVISGAVEI 65 >ref|XP_006347056.1| PREDICTED: probable allantoinase 1-like [Solanum tuberosum] Length = 503 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 SGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 S CSLLP+NHYWISSKRIVT +G ISGAVEI Sbjct: 31 SDCSLLPHNHYWISSKRIVTPNGTISGAVEI 61 >ref|XP_004232860.1| PREDICTED: probable allantoinase 1-like isoform 1 [Solanum lycopersicum] gi|460374123|ref|XP_004232861.1| PREDICTED: probable allantoinase 1-like isoform 2 [Solanum lycopersicum] Length = 503 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 95 SGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 S CSLLP+NHYWISSKRIVT +G ISGAVEI Sbjct: 31 SDCSLLPHNHYWISSKRIVTPNGTISGAVEI 61 >gb|EOY28274.1| Allantoinase, putative isoform 3 [Theobroma cacao] Length = 468 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 98 QSGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 QS CSLLPY+HYWI+SK IVT G+ISGAVE+ Sbjct: 31 QSDCSLLPYSHYWIASKHIVTPQGIISGAVEV 62 >gb|EOY28272.1| Allantoinase, putative isoform 1 [Theobroma cacao] Length = 501 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 98 QSGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 QS CSLLPY+HYWI+SK IVT G+ISGAVE+ Sbjct: 31 QSDCSLLPYSHYWIASKHIVTPQGIISGAVEV 62 >gb|EMJ15029.1| hypothetical protein PRUPE_ppa004531mg [Prunus persica] Length = 504 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 98 QSGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 Q CSLLPY HYWI+SKRIVT G+ISGAVE+ Sbjct: 32 QKNCSLLPYQHYWITSKRIVTPHGIISGAVEV 63 >ref|XP_006396647.1| hypothetical protein EUTSA_v10028578mg [Eutrema salsugineum] gi|557097664|gb|ESQ38100.1| hypothetical protein EUTSA_v10028578mg [Eutrema salsugineum] Length = 520 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 95 SGCSLLPYNHYWISSKRIVTQDGVISGAVEI 3 S CSLLP++HYWISSKRIVT DG+ISG+VE+ Sbjct: 50 SKCSLLPHDHYWISSKRIVTPDGLISGSVEV 80 >ref|XP_006290046.1| hypothetical protein CARUB_v10003686mg [Capsella rubella] gi|482558752|gb|EOA22944.1| hypothetical protein CARUB_v10003686mg [Capsella rubella] Length = 505 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 89 CSLLPYNHYWISSKRIVTQDGVISGAVEI 3 CSLLP++HYWISSKRIVT DG+ISG+VE+ Sbjct: 37 CSLLPHDHYWISSKRIVTPDGLISGSVEV 65 >ref|XP_002874824.1| hypothetical protein ARALYDRAFT_490140 [Arabidopsis lyrata subsp. lyrata] gi|297320661|gb|EFH51083.1| hypothetical protein ARALYDRAFT_490140 [Arabidopsis lyrata subsp. lyrata] Length = 505 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 89 CSLLPYNHYWISSKRIVTQDGVISGAVEI 3 CSLLP++HYWISSKRIVT DG+ISG+VE+ Sbjct: 37 CSLLPHDHYWISSKRIVTPDGLISGSVEV 65