BLASTX nr result
ID: Achyranthes22_contig00048753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048753 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC58614.1| transmembrane protein, putative, partial [Rhizoct... 56 4e-06 >gb|EUC58614.1| transmembrane protein, putative, partial [Rhizoctonia solani AG-3 Rhs1AP] Length = 75 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 116 GDFCGGFAGFQCCEGLGCRLEGDFPDAGGVCVR 214 G FCGG GF C +G+ C+LEGDF DAGGVCV+ Sbjct: 38 GSFCGGIVGFPCNKGMVCKLEGDFADAGGVCVK 70