BLASTX nr result
ID: Achyranthes22_contig00048594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048594 (924 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 78 9e-15 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 78.2 bits (191), Expect(2) = 9e-15 Identities = 37/95 (38%), Positives = 58/95 (61%) Frame = -3 Query: 286 DRSPYLS*HDREILTGPFANCELDKAKLRSMQPYKGEGPDGFHPLFFLKFWGLFSPSMVY 107 D P ++ D E + P + E+ A L+SM+P+K GPDGF PLF+ +FW L P++++ Sbjct: 418 DFFPQITADDFEKMMRPLSEVEVTLA-LKSMKPFKAPGPDGFQPLFYQRFWDLVKPNVMH 476 Query: 106 TVKDVLEGKTFLDS*NDAYFVLITMIQAPQFLKNF 2 V ++L G+ F + ND + VLI + PQ K+F Sbjct: 477 LVSEILSGRDFPEGFNDTFIVLIPKMDIPQLAKHF 511 Score = 29.3 bits (64), Expect(2) = 9e-15 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 395 GNGVQQPGDVKRLVLGY*KILFTED 321 G + P +VK +VLGY K LF+ED Sbjct: 382 GEWISNPMEVKAMVLGYWKHLFSED 406