BLASTX nr result
ID: Achyranthes22_contig00048558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048558 (287 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica] 91 2e-16 sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=At... 85 9e-15 gb|ACA13386.1| beta-amyrin synthase [Artemisia annua] 85 1e-14 gb|EOY25991.1| Beta-Amyrin Synthase [Theobroma cacao] 84 2e-14 gb|EOY25985.1| Terpenoid cyclases family protein [Theobroma cacao] 82 7e-14 emb|CBI18407.3| unnamed protein product [Vitis vinifera] 82 9e-14 emb|CBI18406.3| unnamed protein product [Vitis vinifera] 82 9e-14 emb|CBI18382.3| unnamed protein product [Vitis vinifera] 82 9e-14 sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; ... 82 9e-14 gb|ACB87531.1| beta-amyrin synthase [Artemisia annua] 82 9e-14 sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase gi|181... 81 2e-13 ref|XP_002513299.1| Cycloartenol synthase, putative [Ricinus com... 80 2e-13 sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=... 80 2e-13 gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius] 80 3e-13 ref|XP_002272124.2| PREDICTED: beta-amyrin synthase [Vitis vinif... 80 3e-13 ref|XP_003632933.1| PREDICTED: germanicol synthase-like [Vitis v... 80 3e-13 emb|CBI18392.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002269328.2| PREDICTED: beta-amyrin synthase-like [Vitis ... 80 4e-13 emb|CBI18420.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_002269889.1| PREDICTED: cycloartenol Synthase-like [Vitis... 80 4e-13 >gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica] Length = 760 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI EGA DPYLYSTNNFVGRQTWEFD +YG+PEAI+EVEEAR Sbjct: 1 MWRLKIAEGANDPYLYSTNNFVGRQTWEFDTDYGTPEAIKEVEEAR 46 >sp|F8WQD0.1|SHS1_ASTTA RecName: Full=Shionone synthase; Short=AtaSHS gi|340007143|dbj|BAK52535.1| shionone synthase [Aster tataricus] Length = 761 Score = 85.1 bits (209), Expect = 9e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI +G +PYLYSTNNF+GRQTWEFDPNYG+PE +EVE+AR Sbjct: 1 MWRLKIADGGNNPYLYSTNNFIGRQTWEFDPNYGTPEERDEVEQAR 46 >gb|ACA13386.1| beta-amyrin synthase [Artemisia annua] Length = 761 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI EG DPYLYSTNNFVGRQ WEFDPNYG+PE EVE+AR Sbjct: 1 MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDPNYGTPEERAEVEQAR 46 >gb|EOY25991.1| Beta-Amyrin Synthase [Theobroma cacao] Length = 707 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKIGEG DPYLYSTNN++GRQTWEFDPN G+PE EVEE R Sbjct: 1 MWRLKIGEGGNDPYLYSTNNYLGRQTWEFDPNAGTPEERAEVEEVR 46 >gb|EOY25985.1| Terpenoid cyclases family protein [Theobroma cacao] Length = 1130 Score = 82.0 bits (201), Expect = 7e-14 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKIGEG DPYLYSTNN++GRQTWEFDPN G+P+ EVEE R Sbjct: 1 MWRLKIGEGGNDPYLYSTNNYLGRQTWEFDPNAGTPKERAEVEEVR 46 >emb|CBI18407.3| unnamed protein product [Vitis vinifera] Length = 846 Score = 81.6 bits (200), Expect = 9e-14 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 142 KMWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 KMWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 92 KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 138 >emb|CBI18406.3| unnamed protein product [Vitis vinifera] Length = 910 Score = 81.6 bits (200), Expect = 9e-14 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 142 KMWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 KMWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 141 KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 187 >emb|CBI18382.3| unnamed protein product [Vitis vinifera] Length = 885 Score = 81.6 bits (200), Expect = 9e-14 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 142 KMWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 KMWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 104 KMWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 150 >sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; Short=StrBOS gi|224228177|dbj|BAH23676.1| baccharis oxide synthase [Stevia rebaudiana] Length = 761 Score = 81.6 bits (200), Expect = 9e-14 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI +G +PYLYSTNNFVGRQTWEFDPNYG+ E +EVE+AR Sbjct: 1 MWRLKIADGNNNPYLYSTNNFVGRQTWEFDPNYGTQEERDEVEQAR 46 >gb|ACB87531.1| beta-amyrin synthase [Artemisia annua] Length = 761 Score = 81.6 bits (200), Expect = 9e-14 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI EG DPYLYSTNNFVGRQ WEFD NYG+PE EVE+AR Sbjct: 1 MWRLKIAEGRNDPYLYSTNNFVGRQIWEFDSNYGTPEERAEVEQAR 46 >sp|Q8W3Z1.1|BAMS_BETPL RecName: Full=Beta-amyrin synthase gi|18147596|dbj|BAB83088.1| beta-amyrin synthase [Betula platyphylla] Length = 779 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI +G DPY+YSTNNFVGRQTWEFDP GSP+ EVEEAR Sbjct: 1 MWRLKIADGGSDPYIYSTNNFVGRQTWEFDPQAGSPQERAEVEEAR 46 >ref|XP_002513299.1| Cycloartenol synthase, putative [Ricinus communis] gi|223547207|gb|EEF48702.1| Cycloartenol synthase, putative [Ricinus communis] Length = 757 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLKI +GAG+PYL+STNNF GRQTWE+DP+ G+PE I EVE+AR Sbjct: 1 MWRLKIKDGAGNPYLFSTNNFAGRQTWEYDPDAGTPEEIAEVEQAR 46 >sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS gi|157679391|dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza] Length = 759 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWR+KI EG DPYLYSTNN+VGRQTWEFDP+ G+PE EVEEAR Sbjct: 1 MWRIKIAEGGKDPYLYSTNNYVGRQTWEFDPDAGTPEERAEVEEAR 46 >gb|AAX14716.1| beta-amyrin synthase [Aster sedifolius] Length = 761 Score = 80.1 bits (196), Expect = 3e-13 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWR+ I +G DPYL+STNN+VGRQ WEFDPNYG+PE + EVE+AR Sbjct: 1 MWRMNIAKGGNDPYLFSTNNYVGRQIWEFDPNYGTPEELAEVEQAR 46 >ref|XP_002272124.2| PREDICTED: beta-amyrin synthase [Vitis vinifera] Length = 769 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERNEVEAAR 46 >ref|XP_003632933.1| PREDICTED: germanicol synthase-like [Vitis vinifera] Length = 69 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERNEVEAAR 46 >emb|CBI18392.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERNEVEAAR 46 >ref|XP_002269328.2| PREDICTED: beta-amyrin synthase-like [Vitis vinifera] Length = 773 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYIYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 46 >emb|CBI18420.3| unnamed protein product [Vitis vinifera] Length = 802 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYMYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 46 >ref|XP_002269889.1| PREDICTED: cycloartenol Synthase-like [Vitis vinifera] Length = 758 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 MWRLKIGEGAGDPYLYSTNNFVGRQTWEFDPNYGSPEAIEEVEEAR 2 MWRLK+ +G DPY+YSTNNFVGRQ WEFDP+YG+PE EVE AR Sbjct: 1 MWRLKVADGGNDPYMYSTNNFVGRQIWEFDPDYGTPEERAEVEAAR 46