BLASTX nr result
ID: Achyranthes22_contig00048469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048469 (234 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282080.2| PREDICTED: B3 domain-containing protein At3g... 63 5e-08 emb|CBI32428.3| unnamed protein product [Vitis vinifera] 62 6e-08 gb|EOX98227.1| AP2/B3-like transcriptional factor family protein... 60 4e-07 gb|ABK95016.1| unknown [Populus trichocarpa] 60 4e-07 ref|XP_006354900.1| PREDICTED: B3 domain-containing protein At3g... 59 5e-07 ref|XP_006374960.1| hypothetical protein POPTR_0014s03120g [Popu... 59 5e-07 gb|EMJ22964.1| hypothetical protein PRUPE_ppb024440mg [Prunus pe... 59 7e-07 gb|EXC17357.1| B3 domain-containing protein [Morus notabilis] 59 9e-07 gb|EOY14512.1| AP2/B3-like transcriptional factor family protein... 59 9e-07 ref|XP_004238166.1| PREDICTED: B3 domain-containing protein At5g... 59 9e-07 ref|XP_006473345.1| PREDICTED: B3 domain-containing protein At3g... 58 1e-06 ref|XP_006434799.1| hypothetical protein CICLE_v10002314mg [Citr... 58 1e-06 ref|XP_006487088.1| PREDICTED: B3 domain-containing protein At3g... 57 3e-06 ref|XP_006487087.1| PREDICTED: B3 domain-containing protein At3g... 57 3e-06 ref|XP_006423041.1| hypothetical protein CICLE_v10029072mg [Citr... 57 3e-06 ref|XP_002313112.2| hypothetical protein POPTR_0009s10590g [Popu... 56 4e-06 gb|AFK41850.1| unknown [Medicago truncatula] 56 6e-06 ref|XP_003603025.1| B3 domain-containing protein [Medicago trunc... 56 6e-06 >ref|XP_002282080.2| PREDICTED: B3 domain-containing protein At3g19184-like [Vitis vinifera] Length = 249 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/69 (49%), Positives = 47/69 (68%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRS 195 +SYEE R++R+EENKKRMEELNLHKLS+ L+ + ++ K S K T + +RRS Sbjct: 6 VSYEESRRKRLEENKKRMEELNLHKLSESLRTA--RSPKSSPVKPRTPRSPVDLSAVRRS 63 Query: 196 PRMVENPAP 222 R V+ P+P Sbjct: 64 SRFVDKPSP 72 >emb|CBI32428.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/73 (47%), Positives = 48/73 (65%), Gaps = 4/73 (5%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLK----PSLNKNYKLSVKKKATSDDLSVTTI 183 +SYEE R++R+EENKKRMEELNLHKLS+ L+ P + K+ + + DLS Sbjct: 6 VSYEESRRKRLEENKKRMEELNLHKLSESLRTARSPKSSPVKKVKPRTPRSPVDLSA--- 62 Query: 184 LRRSPRMVENPAP 222 +RRS R V+ P+P Sbjct: 63 VRRSSRFVDKPSP 75 >gb|EOX98227.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] Length = 258 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/68 (47%), Positives = 41/68 (60%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRSP 198 +YE+ RK+R+EENKKRMEELNL LSQ LK + K + K T T +RRS Sbjct: 7 TYEQMRKRRLEENKKRMEELNLKNLSQALKNTSPKPSPMKQMKPRTPRQRVDLTAVRRSS 66 Query: 199 RMVENPAP 222 R+ + P P Sbjct: 67 RVADKPKP 74 >gb|ABK95016.1| unknown [Populus trichocarpa] Length = 192 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRSP 198 +YEE R++RMEENKKRME LNLHKLS+ LK S + K + V ++RRS Sbjct: 7 AYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPMKRSKPRVVEKQV-VVVRRSS 65 Query: 199 RMVENPAP 222 R+ PAP Sbjct: 66 RVANKPAP 73 >ref|XP_006354900.1| PREDICTED: B3 domain-containing protein At3g19184-like [Solanum tuberosum] Length = 239 Score = 59.3 bits (142), Expect = 5e-07 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTI-LRR 192 + YE+ RKQR+EENKKRMEELNL L+Q LK S + K + KK + + +RR Sbjct: 2 VKYEDLRKQRLEENKKRMEELNLPLLTQALKNSTSP--KTTPMKKTKPRIVGTELVAVRR 59 Query: 193 SPRMVENPAPK 225 SPR+ ++PAP+ Sbjct: 60 SPRVAKSPAPE 70 >ref|XP_006374960.1| hypothetical protein POPTR_0014s03120g [Populus trichocarpa] gi|550323273|gb|ERP52757.1| hypothetical protein POPTR_0014s03120g [Populus trichocarpa] Length = 227 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/69 (50%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCLKPSL-NKNYKLSVKKKATSDDLSVTTILRRS 195 +YEE R++RMEENKKRME LNLHKLS+ LK S K+ L K + V ++RRS Sbjct: 7 AYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPLKRSKPRVVEKQVV--VVRRS 64 Query: 196 PRMVENPAP 222 R+ PAP Sbjct: 65 NRIANKPAP 73 >gb|EMJ22964.1| hypothetical protein PRUPE_ppb024440mg [Prunus persica] Length = 222 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 1/70 (1%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLK-PSLNKNYKLSVKKKATSDDLSVTTILRR 192 +SYEE R+QRMEENKKRME LNL +L+Q LK PS K + K T + V ++RR Sbjct: 6 LSYEESRRQRMEENKKRMEALNLPQLAQALKAPSFPKPSPMKRAKPRTVEKQMV--VVRR 63 Query: 193 SPRMVENPAP 222 S R+ P P Sbjct: 64 SSRVANLPTP 73 >gb|EXC17357.1| B3 domain-containing protein [Morus notabilis] Length = 207 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/72 (51%), Positives = 46/72 (63%), Gaps = 3/72 (4%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSV---TTIL 186 ++ EE R+QR+EENKKRMEELNL KL+Q LKPS K+ VKK + L V + L Sbjct: 6 LTNEECRRQRLEENKKRMEELNLTKLAQALKPSSPKS--TPVKKLRPRNGLPVEPSSLPL 63 Query: 187 RRSPRMVENPAP 222 RRS R+ P P Sbjct: 64 RRSSRVSNKPPP 75 >gb|EOY14512.1| AP2/B3-like transcriptional factor family protein, putative [Theobroma cacao] Length = 228 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLK-PSLNKNYKLSVKKKATSDDLSVTTILRR 192 +SYEE R++R+EENKKRME LNL +LSQ L+ PS + + VK + L ++RR Sbjct: 8 LSYEECRRKRVEENKKRMEALNLPQLSQALRTPSFKPSPRKQVKPRTGEKQL---VVVRR 64 Query: 193 SPRMVENPAP 222 S R+ PAP Sbjct: 65 SSRVANKPAP 74 >ref|XP_004238166.1| PREDICTED: B3 domain-containing protein At5g42700-like [Solanum lycopersicum] Length = 237 Score = 58.5 bits (140), Expect = 9e-07 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTI--LR 189 + YE+ RKQR+EENKKRMEELNL L+Q LK N + K T + T + +R Sbjct: 2 VKYEDLRKQRLEENKKRMEELNLPLLTQALK---NSTSPKTTPMKRTKPRVVGTELVAVR 58 Query: 190 RSPRMVENPAPK 225 RSPR+ ++PAP+ Sbjct: 59 RSPRVAKSPAPE 70 >ref|XP_006473345.1| PREDICTED: B3 domain-containing protein At3g19184-like [Citrus sinensis] Length = 241 Score = 57.8 bits (138), Expect = 1e-06 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCL--KPSLNKNYKLSVKKKATSDDLSVTTILRR 192 SYEE R +R+EENKKRME LNL L Q L KPS+ +++ VK + V +LRR Sbjct: 7 SYEECRLKRVEENKKRMEALNLPMLCQALRKKPSIEPSHEKQVKPRTVKKQEDV--VLRR 64 Query: 193 SPRMVENPAP 222 S R+ PAP Sbjct: 65 SSRVANKPAP 74 >ref|XP_006434799.1| hypothetical protein CICLE_v10002314mg [Citrus clementina] gi|557536921|gb|ESR48039.1| hypothetical protein CICLE_v10002314mg [Citrus clementina] Length = 241 Score = 57.8 bits (138), Expect = 1e-06 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCL--KPSLNKNYKLSVKKKATSDDLSVTTILRR 192 SYEE R +R+EENKKRME LNL L Q L KPS+ +++ VK + V +LRR Sbjct: 7 SYEECRLKRVEENKKRMEALNLPMLCQALRKKPSIEPSHEKQVKPRTVKKQEDV--VLRR 64 Query: 193 SPRMVENPAP 222 S R+ PAP Sbjct: 65 SSRVANKPAP 74 >ref|XP_006487088.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform X2 [Citrus sinensis] Length = 266 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRS 195 ++YEE R+QRMEENKKRMEEL L+ L++ LK ++K S KK S + +RRS Sbjct: 6 LTYEECRRQRMEENKKRMEELKLNVLARSLKTPVSKP---SPVKKRVSKPKPASAPVRRS 62 Query: 196 PRMVENPAP 222 R+ + P P Sbjct: 63 SRVADKPPP 71 >ref|XP_006487087.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform X1 [Citrus sinensis] Length = 270 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRS 195 ++YEE R+QRMEENKKRMEEL L+ L++ LK ++K S KK S + +RRS Sbjct: 6 LTYEECRRQRMEENKKRMEELKLNVLARSLKTPVSKP---SPVKKRVSKPKPASAPVRRS 62 Query: 196 PRMVENPAP 222 R+ + P P Sbjct: 63 SRVADKPPP 71 >ref|XP_006423041.1| hypothetical protein CICLE_v10029072mg [Citrus clementina] gi|557524975|gb|ESR36281.1| hypothetical protein CICLE_v10029072mg [Citrus clementina] Length = 265 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/69 (46%), Positives = 44/69 (63%) Frame = +1 Query: 16 MSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRRS 195 ++YEE R+QRMEENKKRMEEL L+ L++ LK ++K S KK S + +RRS Sbjct: 6 LTYEECRRQRMEENKKRMEELKLNVLARSLKTPVSKP---SPVKKRVSKPKPASAPVRRS 62 Query: 196 PRMVENPAP 222 R+ + P P Sbjct: 63 SRVADKPPP 71 >ref|XP_002313112.2| hypothetical protein POPTR_0009s10590g [Populus trichocarpa] gi|550331461|gb|EEE87067.2| hypothetical protein POPTR_0009s10590g [Populus trichocarpa] Length = 270 Score = 56.2 bits (134), Expect = 4e-06 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = +1 Query: 19 SYEEKRKQRMEENKKRMEELNLHKLSQCL--KPSLNKNYKLSVKKKATSDDLSVTTILRR 192 +YEE R++RMEENKKRMEELNL KLSQ L KPS K K + + + +T +RR Sbjct: 7 TYEETRQKRMEENKKRMEELNLTKLSQSLLSKPSPVKKAKPRISRSPVA-----STPVRR 61 Query: 193 SPRMVENP 216 S R+ + P Sbjct: 62 SNRVADKP 69 >gb|AFK41850.1| unknown [Medicago truncatula] Length = 231 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/70 (48%), Positives = 43/70 (61%) Frame = +1 Query: 13 AMSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRR 192 A SYEE R++RMEEN+KRME L+L KLSQ L S + K S K T + ++RR Sbjct: 5 ASSYEESRRKRMEENQKRMEALSLTKLSQSLHKSSSPISKPSPSKPRTPIKKEL-VVVRR 63 Query: 193 SPRMVENPAP 222 S R+ PAP Sbjct: 64 SGRVANMPAP 73 >ref|XP_003603025.1| B3 domain-containing protein [Medicago truncatula] gi|355492073|gb|AES73276.1| B3 domain-containing protein [Medicago truncatula] Length = 231 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/70 (48%), Positives = 43/70 (61%) Frame = +1 Query: 13 AMSYEEKRKQRMEENKKRMEELNLHKLSQCLKPSLNKNYKLSVKKKATSDDLSVTTILRR 192 A SYEE R++RMEEN+KRME L+L KLSQ L S + K S K T + ++RR Sbjct: 5 ASSYEESRRKRMEENQKRMEALSLTKLSQSLHKSSSPISKPSPSKPRTPIKKEL-VVVRR 63 Query: 193 SPRMVENPAP 222 S R+ PAP Sbjct: 64 SGRVANMPAP 73