BLASTX nr result
ID: Achyranthes22_contig00048196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048196 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Popu... 59 9e-07 >ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] gi|550327546|gb|EEE97864.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] Length = 818 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 7/64 (10%) Frame = +2 Query: 8 MALLCFFLFEETAVLKKKDLIYWWVGLGLID-------AEEAADGILNKLIEVDAIEQVV 166 + LLCF +F E +V+KK+ L+YWWVG G ID EE ADGIL K +E +E + Sbjct: 339 LCLLCFSVFPENSVVKKRLLMYWWVGEGFIDPKVDADKPEEVADGILKKFLEKGFVEPEI 398 Query: 167 NSER 178 R Sbjct: 399 KKRR 402