BLASTX nr result
ID: Achyranthes22_contig00048092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00048092 (556 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446422.1| hypothetical protein CICLE_v10017790mg [Citr... 62 1e-07 >ref|XP_006446422.1| hypothetical protein CICLE_v10017790mg [Citrus clementina] gi|557549033|gb|ESR59662.1| hypothetical protein CICLE_v10017790mg [Citrus clementina] Length = 86 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/88 (37%), Positives = 48/88 (54%) Frame = +3 Query: 87 LFIFLLVILNCQFELVEAVRPPPNNFTAVKIVIHVNXXXXXXXXXXILRSHPPSLSGYKV 266 L + ++++L+ F+L+ A RPP H++ + + PPS Y Sbjct: 8 LTLLVVLLLSKSFDLISASRPP-----------HIHPPTIPRGSL-LNKVKPPSFHAYTA 55 Query: 267 NRYKKTETVAYRPTAPGLSPGVGHSVPP 350 NRYK TE+ A+RPT+PG SPGVGH PP Sbjct: 56 NRYKLTESEAFRPTSPGHSPGVGHKGPP 83