BLASTX nr result
ID: Achyranthes22_contig00047980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047980 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006845968.1| hypothetical protein AMTR_s03506p00001230 [A... 61 2e-07 >ref|XP_006845968.1| hypothetical protein AMTR_s03506p00001230 [Amborella trichopoda] gi|548848702|gb|ERN07643.1| hypothetical protein AMTR_s03506p00001230 [Amborella trichopoda] Length = 92 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +3 Query: 231 LSCLS*LVFQYSGVLGIEEPHKSILNLVVTLLW*VGDDTIWEVLQKNS 374 LSCLS + +YSGVLG+EEPH+SI NLVV L GDDT+ EVL+KNS Sbjct: 43 LSCLSSFMVRYSGVLGVEEPHQSIPNLVVKLY--CGDDTVGEVLRKNS 88