BLASTX nr result
ID: Achyranthes22_contig00047847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047847 (274 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ08015.1| hypothetical protein PRUPE_ppa025925mg [Prunus pe... 61 2e-07 ref|XP_002299896.2| hypothetical protein POPTR_0001s24140g [Popu... 60 3e-07 gb|EOY07631.1| Chloroplast-targeted copper chaperone, putative [... 60 3e-07 ref|XP_002531099.1| chloroplast-targeted copper chaperone, putat... 60 3e-07 ref|XP_006363355.1| PREDICTED: uncharacterized protein LOC102581... 60 4e-07 ref|XP_002309432.2| hypothetical protein POPTR_0006s23040g [Popu... 60 4e-07 ref|XP_004251305.1| PREDICTED: uncharacterized protein LOC101261... 60 4e-07 ref|XP_002309431.1| predicted protein [Populus trichocarpa] 60 4e-07 ref|XP_006650801.1| PREDICTED: uncharacterized protein LOC102709... 59 5e-07 ref|NP_001051712.1| Os03g0819400 [Oryza sativa Japonica Group] g... 59 5e-07 ref|XP_004968755.1| PREDICTED: uncharacterized protein LOC101762... 59 7e-07 tpg|DAA54580.1| TPA: hypothetical protein ZEAMMB73_981027 [Zea m... 59 7e-07 ref|XP_002457859.1| hypothetical protein SORBIDRAFT_03g016720 [S... 59 7e-07 gb|ESW04119.1| hypothetical protein PHAVU_011G068700g [Phaseolus... 59 9e-07 gb|ESW04116.1| hypothetical protein PHAVU_011G068500g [Phaseolus... 59 9e-07 gb|EMT29987.1| hypothetical protein F775_17366 [Aegilops tauschii] 59 9e-07 gb|EMS62936.1| hypothetical protein TRIUR3_26593 [Triticum urartu] 59 9e-07 dbj|BAJ91462.1| predicted protein [Hordeum vulgare subsp. vulgar... 59 9e-07 ref|XP_002534052.1| chloroplast-targeted copper chaperone, putat... 59 9e-07 ref|XP_003565192.1| PREDICTED: uncharacterized protein LOC100845... 58 1e-06 >gb|EMJ08015.1| hypothetical protein PRUPE_ppa025925mg [Prunus persica] Length = 237 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF TKKVTVIG+VTPLGVL+S+SKVK AQ W Sbjct: 189 SFSIDFPTKKVTVIGDVTPLGVLSSVSKVKKAQLW 223 >ref|XP_002299896.2| hypothetical protein POPTR_0001s24140g [Populus trichocarpa] gi|550348063|gb|EEE84701.2| hypothetical protein POPTR_0001s24140g [Populus trichocarpa] Length = 282 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF TKKVT+IG+VTPLGVL S+SKVK AQ W Sbjct: 235 SFSIDFATKKVTIIGDVTPLGVLASVSKVKNAQLW 269 >gb|EOY07631.1| Chloroplast-targeted copper chaperone, putative [Theobroma cacao] Length = 296 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF KKVT++G+VTPLGVL S+SKVK AQFW Sbjct: 240 SFSIDFAAKKVTIVGDVTPLGVLASVSKVKSAQFW 274 >ref|XP_002531099.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223529295|gb|EEF31264.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 287 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSID TKKVTVIGNVTPLGVL S+SKVK AQ W Sbjct: 235 SFSIDLATKKVTVIGNVTPLGVLASVSKVKNAQLW 269 >ref|XP_006363355.1| PREDICTED: uncharacterized protein LOC102581501 [Solanum tuberosum] Length = 260 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF+ID +KKVTVIG+VTPLGVLTS+SKVK AQFW Sbjct: 204 SFNIDLASKKVTVIGDVTPLGVLTSVSKVKNAQFW 238 >ref|XP_002309432.2| hypothetical protein POPTR_0006s23040g [Populus trichocarpa] gi|550336907|gb|EEE92955.2| hypothetical protein POPTR_0006s23040g [Populus trichocarpa] Length = 287 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF KKVT++G+VTPLGVL S+SK+K AQFW Sbjct: 236 SFSIDFAAKKVTIVGDVTPLGVLASVSKIKSAQFW 270 >ref|XP_004251305.1| PREDICTED: uncharacterized protein LOC101261297 [Solanum lycopersicum] Length = 258 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF+ID +KKVTVIG+VTPLGVLTS+SKVK AQFW Sbjct: 202 SFNIDLASKKVTVIGDVTPLGVLTSVSKVKNAQFW 236 >ref|XP_002309431.1| predicted protein [Populus trichocarpa] Length = 70 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF KKVT++G+VTPLGVL S+SK+K AQFW Sbjct: 30 SFSIDFAAKKVTIVGDVTPLGVLASVSKIKSAQFW 64 >ref|XP_006650801.1| PREDICTED: uncharacterized protein LOC102709351 [Oryza brachyantha] Length = 200 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF+IDF KKVTV+G+VTPLGVL S+SKVK AQFW Sbjct: 157 SFNIDFAAKKVTVVGDVTPLGVLNSVSKVKNAQFW 191 >ref|NP_001051712.1| Os03g0819400 [Oryza sativa Japonica Group] gi|29124116|gb|AAO65857.1| unknown protein [Oryza sativa Japonica Group] gi|108711778|gb|ABF99573.1| heavy metal-associated domain containing protein, expressed [Oryza sativa Japonica Group] gi|113550183|dbj|BAF13626.1| Os03g0819400 [Oryza sativa Japonica Group] gi|215687343|dbj|BAG91857.1| unnamed protein product [Oryza sativa Japonica Group] gi|218193993|gb|EEC76420.1| hypothetical protein OsI_14088 [Oryza sativa Indica Group] gi|222626054|gb|EEE60186.1| hypothetical protein OsJ_13132 [Oryza sativa Japonica Group] Length = 203 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF+IDF KKVTV+G+VTPLGVL S+SKVK AQFW Sbjct: 161 SFNIDFAAKKVTVVGDVTPLGVLNSVSKVKNAQFW 195 >ref|XP_004968755.1| PREDICTED: uncharacterized protein LOC101762466 [Setaria italica] Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID TKKVTV+G+VTPLGVL SISKVK AQFW Sbjct: 329 SFDIDIATKKVTVVGDVTPLGVLNSISKVKSAQFW 363 >tpg|DAA54580.1| TPA: hypothetical protein ZEAMMB73_981027 [Zea mays] Length = 334 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID TKKVTV+G+VTPLGVL SISKVK AQFW Sbjct: 283 SFDIDIATKKVTVVGDVTPLGVLNSISKVKSAQFW 317 >ref|XP_002457859.1| hypothetical protein SORBIDRAFT_03g016720 [Sorghum bicolor] gi|241929834|gb|EES02979.1| hypothetical protein SORBIDRAFT_03g016720 [Sorghum bicolor] Length = 327 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID TKKVTV+G+VTPLGVL SISKVK AQFW Sbjct: 276 SFDIDIATKKVTVVGDVTPLGVLNSISKVKSAQFW 310 >gb|ESW04119.1| hypothetical protein PHAVU_011G068700g [Phaseolus vulgaris] Length = 216 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSI+ ETKKVT+IG+VTPLGVL S+SKVK AQ W Sbjct: 179 SFSIEMETKKVTIIGDVTPLGVLASVSKVKSAQLW 213 >gb|ESW04116.1| hypothetical protein PHAVU_011G068500g [Phaseolus vulgaris] Length = 197 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSI+ ETKKVT+IG+VTPLGVL S+SKVK AQ W Sbjct: 160 SFSIEMETKKVTIIGDVTPLGVLASVSKVKNAQLW 194 >gb|EMT29987.1| hypothetical protein F775_17366 [Aegilops tauschii] Length = 166 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID +KKVTV+G+VTPLGVLTS+SKVK AQFW Sbjct: 119 SFDIDIPSKKVTVVGDVTPLGVLTSVSKVKPAQFW 153 >gb|EMS62936.1| hypothetical protein TRIUR3_26593 [Triticum urartu] Length = 248 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID +KKVTV+G+VTPLGVLTS+SKVK AQFW Sbjct: 201 SFDIDIPSKKVTVVGDVTPLGVLTSVSKVKPAQFW 235 >dbj|BAJ91462.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326507680|dbj|BAK03233.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 321 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID +KKVTV+G+VTPLGVLTS+SKVK AQFW Sbjct: 274 SFDIDIASKKVTVVGDVTPLGVLTSVSKVKPAQFW 308 >ref|XP_002534052.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223525923|gb|EEF28330.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Length = 289 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SFSIDF KKVT++G+V+PLGVL S+SKVK AQFW Sbjct: 238 SFSIDFAAKKVTIVGDVSPLGVLASVSKVKSAQFW 272 >ref|XP_003565192.1| PREDICTED: uncharacterized protein LOC100845276 [Brachypodium distachyon] Length = 302 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 SFSIDFETKKVTVIGNVTPLGVLTSISKVKYAQFW 107 SF ID TKKVTV+G+VTPLGVL S+SK+K AQFW Sbjct: 251 SFQIDIATKKVTVVGDVTPLGVLNSVSKIKAAQFW 285