BLASTX nr result
ID: Achyranthes22_contig00047844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047844 (350 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P23525.1|IN37_SPIOL RecName: Full=2-methyl-6-phytyl-1,4-hydro... 80 2e-13 dbj|BAH10641.1| 2-methyl-6-phytylbenzoquinone methyltranferase [... 57 2e-06 >sp|P23525.1|IN37_SPIOL RecName: Full=2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic; AltName: Full=37 kDa inner envelope membrane protein; Short=E37; AltName: Full=MPBQ/MSBQ methyltransferase; Flags: Precursor gi|21228|emb|CAA40283.1| 37 kD inner envelope membrane polypeptide [Spinacia oleracea] Length = 344 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Frame = -2 Query: 181 MACSMLIGADKLTLLSGTTPNRLGFSGSNFNGKYKIPNLSLAPRPRTLREKTL--VPKCS 8 MACSML G DKL L+SG TPNRL FSGS+F G YK+P L+L P R LR KTL V KC+ Sbjct: 1 MACSMLNGVDKLALISGKTPNRLRFSGSDFTGSYKLPRLNLPPNSRNLRAKTLTTVTKCT 60 Query: 7 LS 2 LS Sbjct: 61 LS 62 >dbj|BAH10641.1| 2-methyl-6-phytylbenzoquinone methyltranferase [Hevea brasiliensis] Length = 340 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -2 Query: 181 MACSMLIGADKLTLLSGTTPNRLGFSGSNFNGKYKIPNLSLAPRPRTLREKTLVPKCSLS 2 MA ML GA+ TL+SG TP LGF GS+F+G + P ++L R R +T++PKC+LS Sbjct: 1 MASLMLNGAENFTLMSGITPKGLGFLGSDFHGNH-FPRVNLISSSRISRTRTVMPKCNLS 59