BLASTX nr result
ID: Achyranthes22_contig00047616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047616 (223 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 103 2e-20 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 103 bits (258), Expect = 2e-20 Identities = 50/72 (69%), Positives = 59/72 (81%) Frame = +3 Query: 6 QKVDLASLNMIDKAEHWMGSYMAVRNQVDWDGFVIDVISRFMEEKGSNVVELFNKLQQDD 185 QKVDLASLNM+DKAE+W+ SY+ R VDW+ FVIDV SRF +E G NVVE FNKLQQ + Sbjct: 65 QKVDLASLNMVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQTN 124 Query: 186 SLENYIDEFENL 221 SLE+YIDEFE + Sbjct: 125 SLEDYIDEFEKV 136