BLASTX nr result
ID: Achyranthes22_contig00047470
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047470 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633481.1| PREDICTED: uncharacterized protein LOC100254... 59 5e-07 gb|EOY18888.1| F-box and Leucine Rich Repeat domains containing ... 58 2e-06 emb|CBI31378.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_003633481.1| PREDICTED: uncharacterized protein LOC100254715 [Vitis vinifera] Length = 1395 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 334 KMFKLQRYKSGKSEHKFAFQFSDFQAIKVPKGWDKLFVSL 453 KMF+L R+K KS H+F F FS FQA++VPKGWDKL VS+ Sbjct: 15 KMFRLHRHKPDKSGHRFHFNFSGFQALQVPKGWDKLCVSI 54 >gb|EOY18888.1| F-box and Leucine Rich Repeat domains containing protein, putative isoform 3, partial [Theobroma cacao] Length = 1520 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 337 MFKLQRYKSGKSEHKFAFQFSDFQAIKVPKGWDKLFVSL 453 MF+L + KS KS +F F+FS FQA++VPKGWDKLFVS+ Sbjct: 1 MFRLHKQKSDKSGERFDFKFSSFQALQVPKGWDKLFVSI 39 >emb|CBI31378.3| unnamed protein product [Vitis vinifera] Length = 1338 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 337 MFKLQRYKSGKSEHKFAFQFSDFQAIKVPKGWDKLFVSL 453 MF+L R+K KS H+F F FS FQA++VPKGWDKL VS+ Sbjct: 1 MFRLHRHKPDKSGHRFHFNFSGFQALQVPKGWDKLCVSI 39