BLASTX nr result
ID: Achyranthes22_contig00047364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047364 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322643.2| hypothetical protein POPTR_0016s04060g [Popu... 55 1e-05 >ref|XP_002322643.2| hypothetical protein POPTR_0016s04060g [Populus trichocarpa] gi|550320782|gb|EEF04404.2| hypothetical protein POPTR_0016s04060g [Populus trichocarpa] Length = 1241 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/77 (38%), Positives = 45/77 (58%) Frame = +3 Query: 93 NPDKGLARTSSLRPLRILAKIPSMRPRRCKVKKELEDSPQSGTGFDRPTCSSTLKRNQLP 272 N + + RTS+LRP+RIL K+ S+R +R +KK S +G + TCSS +K ++ P Sbjct: 229 NSMRVMTRTSTLRPVRILTKVASIRTKRPSMKKR---SQIPDSGIQKATCSSAIKDSKFP 285 Query: 273 VEIGLHSRHRELEGTSS 323 + L RE EG S+ Sbjct: 286 YHLELQPEGRESEGNSA 302