BLASTX nr result
ID: Achyranthes22_contig00047157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047157 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006408987.1| hypothetical protein EUTSA_v10001903mg [Eutr... 68 1e-09 ref|XP_002884212.1| AtRPN1a/RPN1A [Arabidopsis lyrata subsp. lyr... 64 2e-08 ref|NP_565477.1| 26S proteasome regulatory subunit S2 1A [Arabid... 64 2e-08 ref|XP_006299966.1| hypothetical protein CARUB_v10016177mg [Caps... 64 2e-08 ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 64 3e-08 ref|XP_006285481.1| hypothetical protein CARUB_v10006910mg [Caps... 63 3e-08 ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulat... 63 3e-08 ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|5... 63 5e-08 gb|ESW04772.1| hypothetical protein PHAVU_011G124300g [Phaseolus... 62 8e-08 ref|XP_006412951.1| hypothetical protein EUTSA_v10024363mg [Eutr... 62 8e-08 ref|XP_006412950.1| hypothetical protein EUTSA_v10024363mg [Eutr... 62 8e-08 ref|XP_004303093.1| PREDICTED: 26S proteasome non-ATPase regulat... 61 1e-07 gb|EMJ00127.1| hypothetical protein PRUPE_ppa001162mg [Prunus pe... 61 1e-07 ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulat... 61 1e-07 ref|XP_002310411.1| hypothetical protein POPTR_0007s01200g [Popu... 61 1e-07 ref|NP_194576.5| 26S proteasome non-ATPase regulatory subunit 2 ... 61 1e-07 emb|CAA16886.1| putative protein [Arabidopsis thaliana] gi|72697... 61 1e-07 ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulat... 61 2e-07 ref|XP_006470158.1| PREDICTED: 26S proteasome non-ATPase regulat... 60 4e-07 ref|XP_006446692.1| hypothetical protein CICLE_v10014210mg [Citr... 60 4e-07 >ref|XP_006408987.1| hypothetical protein EUTSA_v10001903mg [Eutrema salsugineum] gi|557110143|gb|ESQ50440.1| hypothetical protein EUTSA_v10001903mg [Eutrema salsugineum] Length = 891 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP LAL GDY+DNED ++RI I+GL IAY + Sbjct: 453 VGIVNCGIKNDCDPALALLGDYIDNEDSSVRIGAIMGLGIAYAGS 497 >ref|XP_002884212.1| AtRPN1a/RPN1A [Arabidopsis lyrata subsp. lyrata] gi|297330052|gb|EFH60471.1| AtRPN1a/RPN1A [Arabidopsis lyrata subsp. lyrata] Length = 891 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP LAL GDY+D ED ++RI I+GL I+Y + Sbjct: 453 VGIVNCGIKNDCDPALALLGDYIDKEDSSVRIGAIMGLGISYAGS 497 >ref|NP_565477.1| 26S proteasome regulatory subunit S2 1A [Arabidopsis thaliana] gi|75265911|sp|Q9SIV2.2|PSD2A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 2 homolog A; AltName: Full=26S proteasome regulatory subunit RPN1a; Short=AtRPN1a; AltName: Full=26S proteasome regulatory subunit S2 homolog A gi|13430608|gb|AAK25926.1|AF360216_1 putative 26S proteasome regulatory subunit S2 [Arabidopsis thaliana] gi|14532874|gb|AAK64119.1| putative 26S proteasome regulatory subunit S2 [Arabidopsis thaliana] gi|20198043|gb|AAD21708.2| 26S proteasome regulatory subunit S2 (RPN1) [Arabidopsis thaliana] gi|32700010|gb|AAP86655.1| 26S proteasome subunit RPN1a [Arabidopsis thaliana] gi|330251938|gb|AEC07032.1| 26S proteasome regulatory subunit S2 1A [Arabidopsis thaliana] Length = 891 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP LAL GDY+D ED ++RI I+GL I+Y + Sbjct: 453 VGIVNCGIKNDCDPALALLGDYIDKEDSSVRIGAIMGLGISYAGS 497 >ref|XP_006299966.1| hypothetical protein CARUB_v10016177mg [Capsella rubella] gi|482568675|gb|EOA32864.1| hypothetical protein CARUB_v10016177mg [Capsella rubella] Length = 891 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCG++NDCDP LAL GDY+D ED ++RI I+GL I+Y + Sbjct: 453 VGIVNCGVKNDCDPALALLGDYIDKEDSSVRIGAIMGLGISYAGS 497 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNC I+NDCDP LAL GDY+D ED +IRI I+GL IAY + Sbjct: 456 VGIVNCSIKNDCDPALALLGDYIDKEDSSIRIGAIMGLGIAYAGS 500 >ref|XP_006285481.1| hypothetical protein CARUB_v10006910mg [Capsella rubella] gi|482554186|gb|EOA18379.1| hypothetical protein CARUB_v10006910mg [Capsella rubella] Length = 890 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 + IVNCGI+NDCDP LAL GDY+D ED ++RI I+GL IA+ + Sbjct: 452 IGIVNCGIKNDCDPALALLGDYIDKEDSSVRIGAIMGLGIAHAGS 496 >ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] Length = 885 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNC I+NDCDP +AL GDY+D ED +IRI I+GL IAY + Sbjct: 447 VGIVNCSIKNDCDPAMALLGDYIDKEDTSIRIGAIMGLGIAYAGS 491 >ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|566211390|ref|XP_006372747.1| hypothetical protein POPTR_0017s04660g [Populus trichocarpa] gi|550319395|gb|ERP50544.1| hypothetical protein POPTR_0017s04660g [Populus trichocarpa] Length = 890 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI NDCDP LAL D+VD ED +IRI I+GL IAY T Sbjct: 451 VGIVNCGIRNDCDPALALLDDFVDKEDPSIRIGAIMGLGIAYAGT 495 >gb|ESW04772.1| hypothetical protein PHAVU_011G124300g [Phaseolus vulgaris] Length = 885 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNC I+NDCDP +AL GDY D ED +IRI I+GL IAY + Sbjct: 447 VGIVNCSIKNDCDPAMALLGDYTDKEDTSIRIGAIMGLGIAYAGS 491 >ref|XP_006412951.1| hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] gi|557114121|gb|ESQ54404.1| hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] Length = 891 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP LAL G+Y++ ED ++RI I+GL IAY + Sbjct: 453 VGIVNCGIKNDCDPALALLGEYIEKEDPSVRIGAIMGLGIAYAGS 497 >ref|XP_006412950.1| hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] gi|557114120|gb|ESQ54403.1| hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] Length = 746 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP LAL G+Y++ ED ++RI I+GL IAY + Sbjct: 453 VGIVNCGIKNDCDPALALLGEYIEKEDPSVRIGAIMGLGIAYAGS 497 >ref|XP_004303093.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Fragaria vesca subsp. vesca] Length = 892 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAY 328 V IVNC I+NDCDP LAL G+Y+D ED +IRI I+GL IAY Sbjct: 454 VGIVNCSIKNDCDPALALLGEYIDKEDPSIRIGAIMGLGIAY 495 >gb|EMJ00127.1| hypothetical protein PRUPE_ppa001162mg [Prunus persica] Length = 892 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAY 328 V IVNC I+NDCDP LAL G+Y+D ED +IRI I+GL IAY Sbjct: 453 VGIVNCSIKNDCDPALALLGEYIDKEDPSIRIGAIMGLGIAY 494 >ref|XP_003539943.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Glycine max] Length = 885 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNC I+NDCDP +AL GDY+D ED + RI I+GL IAY + Sbjct: 447 VGIVNCSIKNDCDPAMALLGDYIDKEDTSTRIGAIMGLGIAYAGS 491 >ref|XP_002310411.1| hypothetical protein POPTR_0007s01200g [Populus trichocarpa] gi|222853314|gb|EEE90861.1| hypothetical protein POPTR_0007s01200g [Populus trichocarpa] Length = 890 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI NDCDP LAL D+VD E+ +IRI I+GL IAY T Sbjct: 451 VGIVNCGIRNDCDPALALLDDFVDKEEPSIRIGAIMGLGIAYAGT 495 >ref|NP_194576.5| 26S proteasome non-ATPase regulatory subunit 2 1B [Arabidopsis thaliana] gi|75130218|sp|Q6XJG8.1|PSD2B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 2 homolog B; AltName: Full=26S proteasome regulatory subunit RPN1b; Short=AtRPN1b; AltName: Full=26S proteasome regulatory subunit S2 homolog B gi|32700012|gb|AAP86656.1| 26S proteasome subunit RPN1b [Arabidopsis thaliana] gi|332660090|gb|AEE85490.1| 26S proteasome non-ATPase regulatory subunit 2 1B [Arabidopsis thaliana] Length = 891 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP AL Y+DNED ++RI I+GL IAY + Sbjct: 453 VGIVNCGIKNDCDPAFALLSGYIDNEDSSVRIGAIMGLGIAYAGS 497 >emb|CAA16886.1| putative protein [Arabidopsis thaliana] gi|7269701|emb|CAB79649.1| putative protein [Arabidopsis thaliana] Length = 1103 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI+NDCDP AL Y+DNED ++RI I+GL IAY + Sbjct: 496 VGIVNCGIKNDCDPAFALLSGYIDNEDSSVRIGAIMGLGIAYAGS 540 >ref|XP_004505542.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cicer arietinum] Length = 886 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNC I+NDCDP +AL GDY+D ED + RI I+GL IAY + Sbjct: 448 VGIVNCSIKNDCDPAMALLGDYIDKEDSSTRIGAIMGLGIAYAGS 492 >ref|XP_006470158.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Citrus sinensis] Length = 891 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI NDCDP LAL +YV ED IRI I+GL I+Y T Sbjct: 452 VGIVNCGIRNDCDPALALLSEYVGREDACIRIGAIMGLGISYAGT 496 >ref|XP_006446692.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] gi|557549303|gb|ESR59932.1| hypothetical protein CICLE_v10014210mg [Citrus clementina] Length = 872 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/45 (62%), Positives = 31/45 (68%) Frame = +2 Query: 203 VRIVNCGIENDCDPDLALFGDYVDNEDLAIRINVIIGLCIAYTNT 337 V IVNCGI NDCDP LAL +YV ED IRI I+GL I+Y T Sbjct: 452 VGIVNCGIRNDCDPALALLSEYVGREDACIRIGAIMGLGISYAGT 496