BLASTX nr result
ID: Achyranthes22_contig00047123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00047123 (267 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW07604.1| hypothetical protein PHAVU_010G143400g [Phaseolus... 70 4e-10 ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containi... 69 8e-10 ref|XP_003625044.1| Pentatricopeptide repeat-containing protein ... 67 2e-09 ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 emb|CAN67349.1| hypothetical protein VITISV_018089 [Vitis vinifera] 65 7e-09 gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus pe... 62 6e-08 ref|XP_002530223.1| pentatricopeptide repeat-containing protein,... 62 8e-08 gb|EXB98292.1| hypothetical protein L484_014278 [Morus notabilis] 61 1e-07 ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [A... 61 1e-07 gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily p... 60 3e-07 ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_002869597.1| pentatricopeptide repeat-containing protein ... 58 1e-06 ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutr... 57 2e-06 ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Popu... 57 3e-06 ref|NP_194398.1| pentatricopeptide repeat-containing protein [Ar... 55 7e-06 >gb|ESW07604.1| hypothetical protein PHAVU_010G143400g [Phaseolus vulgaris] Length = 518 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/61 (54%), Positives = 47/61 (77%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++LIS C+NEDF+GA++VLR+ML R + P+S +LSELC+GL R G++ A L E+EA Sbjct: 436 QMLISAFCKNEDFDGAVQVLRDMLGRLLSPDSSMLSELCHGLGRCGKSQLALSLCSEMEA 495 Query: 181 R 183 R Sbjct: 496 R 496 >ref|XP_003531640.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like isoform 2 [Glycine max] Length = 522 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/61 (52%), Positives = 44/61 (72%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++LIS C+NEDF+GA++VLR+ML R M P+ +SELC+GLCR G+ A L E+E Sbjct: 439 QMLISAFCKNEDFDGAVQVLRDMLGRLMSPDLSTMSELCDGLCRCGKNQLALALCSEMEV 498 Query: 181 R 183 R Sbjct: 499 R 499 >ref|XP_004510327.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Cicer arietinum] Length = 515 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/60 (55%), Positives = 44/60 (73%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 VL+S C+NEDF+GA+ VLR+ML R M +S +LSE+C+GLCR GR A L E+EA+ Sbjct: 433 VLVSAFCKNEDFDGAVEVLRDMLDRFMALDSCILSEVCSGLCRCGRKQLALMLCSEIEAK 492 >ref|XP_003625044.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500059|gb|AES81262.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 521 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +L S C+NEDF+GA++VLR+ML R M P+S +LSE+ +GLCR GR A L E+EA+ Sbjct: 436 MLASAFCKNEDFDGAVQVLRDMLERFMTPDSSILSEVYSGLCRCGRKQFALMLCSEIEAK 495 >ref|XP_002269867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Vitis vinifera] Length = 616 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/61 (50%), Positives = 45/61 (73%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++LIS C+NEDF+GA+ V+REM RS+ P+SD LSELC GL +G+ + A +L E+E Sbjct: 528 KMLISTFCKNEDFDGAVEVVREMSERSIAPDSDTLSELCRGLWLSGKEELALKLCKEMEM 587 Query: 181 R 183 + Sbjct: 588 K 588 >emb|CAN67349.1| hypothetical protein VITISV_018089 [Vitis vinifera] Length = 483 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/61 (50%), Positives = 45/61 (73%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++LIS C+NEDF+GA+ V+REM RS+ P+SD LSELC GL +G+ + A +L E+E Sbjct: 395 KMLISTFCKNEDFDGAVEVVREMSERSIAPDSDTLSELCRGLWLSGKEELALKLCKEMEM 454 Query: 181 R 183 + Sbjct: 455 K 455 >gb|EMJ17863.1| hypothetical protein PRUPE_ppb017187mg [Prunus persica] Length = 533 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +LIS C N DF+GA+ VL+EM RS +S +LS+LC GLCR G + L E+EAR Sbjct: 453 MLISSFCNNRDFDGAVEVLKEMFDRSFALDSSILSDLCQGLCRCGNEKMVKLLCSEMEAR 512 >ref|XP_002530223.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530270|gb|EEF32170.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 517 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/60 (51%), Positives = 40/60 (66%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +L+S C+NEDFEGA VL EM R P SDVLSE+ +GLC G+ A +L E++AR Sbjct: 431 MLVSAFCKNEDFEGAFLVLMEMFERCFTPGSDVLSEIYHGLCCCGKEHLAMKLSSELKAR 490 >gb|EXB98292.1| hypothetical protein L484_014278 [Morus notabilis] Length = 520 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++LIS+ C+NEDF+G VLREM R + P+ DV +LC GLCR G+ L E+EA Sbjct: 259 QMLISIFCKNEDFDGGAEVLREMFDRFVVPDLDVFYKLCAGLCRVGKEKLVMLLCSEMEA 318 Query: 181 R 183 R Sbjct: 319 R 319 >ref|XP_006843235.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] gi|548845519|gb|ERN04910.1| hypothetical protein AMTR_s00080p00074320 [Amborella trichopoda] Length = 489 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +1 Query: 7 LISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 LIS C+NEDFEG ++LREML R P+S + EL GLCR G + E+L ++EAR Sbjct: 410 LISSFCKNEDFEGGAQILREMLDRGQAPDSTLFVELFEGLCRCGNSKMVERLLRDMEAR 468 >gb|EOX93483.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 532 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/60 (50%), Positives = 43/60 (71%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +LIS C+NEDF+GA++VL +M+ RS+ P+S LSEL NGLC+ G+ A L ++E R Sbjct: 449 MLISTFCKNEDFDGAVQVLNDMIDRSVVPDSGTLSELHNGLCQCGKDQLAMILCKKLEDR 508 >ref|XP_004303560.1| PREDICTED: pentatricopeptide repeat-containing protein At4g26680, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 539 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/61 (44%), Positives = 42/61 (68%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++L+S C N DF+GA+ +L+EM R+ P+SD++S+LC GL R G+ E L E+E+ Sbjct: 452 KMLLSSFCNNRDFDGAVEILKEMFERNFVPDSDIVSDLCLGLRRCGKGKLVELLCREMES 511 Query: 181 R 183 R Sbjct: 512 R 512 >ref|XP_002869597.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315433|gb|EFH45856.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 538 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/70 (40%), Positives = 43/70 (61%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +LIS C+NEDF+GA +VLREM+ RS+ +S + ++CNGL G+ ++L E+E + Sbjct: 453 ILISAFCKNEDFDGAAQVLREMVRRSIPLDSRTVHQVCNGLNHQGKDQLVKELLQEMEGK 512 Query: 184 CRGSEVTSRC 213 E C Sbjct: 513 KFLQEPLDNC 522 >ref|XP_006413152.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] gi|557114322|gb|ESQ54605.1| hypothetical protein EUTSA_v10024897mg [Eutrema salsugineum] Length = 528 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +L+S C+N+DF+GA +VLREM+ RS+ +S + ++CNGL G+ A +L E+EA+ Sbjct: 460 MLVSAFCKNDDFDGAAQVLREMVRRSIPLDSRTVHQVCNGLKHQGKDQLATELLQEMEAK 519 >ref|XP_002320514.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] gi|550324329|gb|EEE98829.2| hypothetical protein POPTR_0014s16390g [Populus trichocarpa] Length = 506 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/61 (47%), Positives = 42/61 (68%) Frame = +1 Query: 1 EVLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEA 180 ++L S +NEDFEGA VL +M ARSM +S+ L E+ +GLC+ G+ + A +L E+EA Sbjct: 421 KMLTSAFVKNEDFEGAFNVLMDMFARSMASDSNTLLEIYDGLCQCGKENLAMKLCHEMEA 480 Query: 181 R 183 R Sbjct: 481 R 481 >ref|NP_194398.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186944|ref|NP_001190849.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213515|sp|Q9SZ10.1|PP338_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g26680, mitochondrial; Flags: Precursor gi|4455191|emb|CAB36514.1| putative protein [Arabidopsis thaliana] gi|7269520|emb|CAB79523.1| putative protein [Arabidopsis thaliana] gi|332659836|gb|AEE85236.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659837|gb|AEE85237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 521 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/60 (41%), Positives = 41/60 (68%) Frame = +1 Query: 4 VLISLMCQNEDFEGAIRVLREMLARSMHPNSDVLSELCNGLCRNGRADSAEQLRDEVEAR 183 +L+S C+NEDF+GA +VLREM+ RS+ +S + ++CNGL G+ ++L E+E + Sbjct: 453 MLVSAFCRNEDFDGASQVLREMVRRSIPLDSRTVHQVCNGLKHQGKDQLVKKLLQEMEGK 512