BLASTX nr result
ID: Achyranthes22_contig00046241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00046241 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173875.1| PREDICTED: DNA-directed RNA polymerase subun... 104 1e-41 ref|XP_003606056.1| 30S ribosomal protein S11 [Medicago truncatu... 95 8e-38 gb|ESW33153.1| hypothetical protein PHAVU_001G047500g [Phaseolus... 102 3e-24 ref|YP_008999967.1| ribosomal protein S11 (chloroplast) [Agroste... 108 6e-22 ref|YP_008963512.1| ribosomal protein S11 (chloroplast) [Penthor... 108 6e-22 ref|NP_054967.1| ribosomal protein S11 [Spinacia oleracea] gi|19... 108 6e-22 gb|AEX65488.1| 30S ribosomal protein S11 [Portulaca oleracea] 108 6e-22 gb|AEX65485.1| 30S ribosomal protein S11 [Portulacaria afra] 108 6e-22 ref|YP_005089366.1| rps11 gene product (chloroplast) [Silene vul... 108 6e-22 pdb|3BBN|K Chain K, Homology Model For The Spinach Chloroplast 3... 108 6e-22 ref|YP_008578121.1| ribosomal protein S11 (chloroplast) [Allosyn... 107 1e-21 ref|YP_008577611.1| ribosomal protein S11 (chloroplast) [Corymbi... 107 1e-21 ref|YP_008577016.1| ribosomal protein S11 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_008576081.1| ribosomal protein S11 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_008575656.1| ribosomal protein S11 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_008575486.1| ribosomal protein S11 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_008575146.1| ribosomal protein S11 (chloroplast) [Eucalyp... 107 1e-21 ref|YP_007889894.1| ribosomal protein S11 [Francoa sonchifolia] ... 107 1e-21 ref|YP_636332.1| ribosomal protein S11 [Eucalyptus globulus subs... 107 1e-21 gb|AFS35504.1| ribosomal protein S11, partial [Fragaria moschata] 107 1e-21 >ref|XP_004173875.1| PREDICTED: DNA-directed RNA polymerase subunit alpha-like [Cucumis sativus] Length = 466 Score = 104 bits (260), Expect(2) = 1e-41 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++R VV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSF+RDVTPMPHNGC Sbjct: 77 GNAIRGVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFIRDVTPMPHNGC 130 Score = 90.9 bits (224), Expect(2) = 1e-41 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 150 REKIRVSTRTLQWKCVESRTDSKCLYYGRFILSPLMKGQADTIGIAIRRA 1 R+KIRVSTRTL+WKCVESR DSK LYYGRFILSPLMKGQ DTIGIA+R+A Sbjct: 136 RQKIRVSTRTLKWKCVESRADSKRLYYGRFILSPLMKGQGDTIGIAMRKA 185 >ref|XP_003606056.1| 30S ribosomal protein S11 [Medicago truncatula] gi|355507111|gb|AES88253.1| 30S ribosomal protein S11 [Medicago truncatula] Length = 466 Score = 95.1 bits (235), Expect(2) = 8e-38 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -2 Query: 413 NSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 N++RTVV+QGMQRA V+IKGPGLGRDAALRAI RSGILL F+RDVTP+PHNGC Sbjct: 78 NAIRTVVDQGMQRAVVIIKGPGLGRDAALRAIARSGILLRFIRDVTPIPHNGC 130 Score = 87.8 bits (216), Expect(2) = 8e-38 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 150 REKIRVSTRTLQWKCVESRTDSKCLYYGRFILSPLMKGQADTIGIAIRR 4 R+K++VS RTLQWKCVESR DSK LYYGRFILSPL KGQADTIGIA+RR Sbjct: 136 RQKVKVSARTLQWKCVESRVDSKRLYYGRFILSPLRKGQADTIGIAMRR 184 >gb|ESW33153.1| hypothetical protein PHAVU_001G047500g [Phaseolus vulgaris] Length = 181 Score = 102 bits (253), Expect(2) = 3e-24 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTV +QGMQRAE+MIKGPGLGRDA LRAIRRSGILL+F+RDVTPMPHNGC Sbjct: 77 GNAIRTVSDQGMQRAEIMIKGPGLGRDATLRAIRRSGILLNFIRDVTPMPHNGC 130 Score = 35.4 bits (80), Expect(2) = 3e-24 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -3 Query: 160 YYGSRENKSIYSDTAVEVC 104 YYGSRE KS+YSDT +E+C Sbjct: 163 YYGSREIKSLYSDTTMEMC 181 >ref|YP_008999967.1| ribosomal protein S11 (chloroplast) [Agrostemma githago] gi|555944054|gb|AGZ17958.1| ribosomal protein S11 (chloroplast) [Agrostemma githago] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008963512.1| ribosomal protein S11 (chloroplast) [Penthorum chinense] gi|403226813|gb|AFR25692.1| ribosomal protein S11 (chloroplast) [Penthorum chinense] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|NP_054967.1| ribosomal protein S11 [Spinacia oleracea] gi|19855077|sp|P06506.4|RR11_SPIOL RecName: Full=30S ribosomal protein S11, chloroplastic gi|7636140|emb|CAB88760.1| ribosomal protein S11 [Spinacia oleracea] gi|372000807|gb|AEX65480.1| 30S ribosomal protein S11 [Anredera baselloides] gi|372000811|gb|AEX65482.1| 30S ribosomal protein S11 [Didierea madagascariensis] gi|372000815|gb|AEX65484.1| 30S ribosomal protein S11 [Mollugo verticillata] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >gb|AEX65488.1| 30S ribosomal protein S11 [Portulaca oleracea] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >gb|AEX65485.1| 30S ribosomal protein S11 [Portulacaria afra] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_005089366.1| rps11 gene product (chloroplast) [Silene vulgaris] gi|374249983|ref|YP_005089609.1| rps11 gene product (chloroplast) [Silene latifolia] gi|329755554|gb|AEC04117.1| ribosomal protein S11 (chloroplast) [Silene latifolia] gi|329755719|gb|AEC04280.1| ribosomal protein S11 (chloroplast) [Silene vulgaris] Length = 138 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >pdb|3BBN|K Chain K, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 140 Score = 108 bits (271), Expect = 6e-22 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 79 GNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 132 >ref|YP_008578121.1| ribosomal protein S11 (chloroplast) [Allosyncarpia ternata] gi|442569368|gb|AGC59530.1| ribosomal protein S11 (chloroplast) [Allosyncarpia ternata] Length = 130 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 69 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 122 >ref|YP_008577611.1| ribosomal protein S11 (chloroplast) [Corymbia gummifera] gi|442568852|gb|AGC59020.1| ribosomal protein S11 (chloroplast) [Corymbia gummifera] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008577016.1| ribosomal protein S11 (chloroplast) [Eucalyptus spathulata] gi|442568250|gb|AGC58425.1| ribosomal protein S11 (chloroplast) [Eucalyptus spathulata] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008576081.1| ribosomal protein S11 (chloroplast) [Eucalyptus patens] gi|545717396|ref|YP_008576251.1| ribosomal protein S11 (chloroplast) [Eucalyptus curtisii] gi|545718428|ref|YP_008577271.1| ribosomal protein S11 (chloroplast) [Eucalyptus salmonophloia] gi|545718514|ref|YP_008577356.1| ribosomal protein S11 (chloroplast) [Eucalyptus microcorys] gi|545718600|ref|YP_008577441.1| ribosomal protein S11 (chloroplast) [Eucalyptus guilfoylei] gi|545718686|ref|YP_008577526.1| ribosomal protein S11 (chloroplast) [Eucalyptus erythrocorys] gi|545718858|ref|YP_008577696.1| ribosomal protein S11 (chloroplast) [Corymbia maculata] gi|545718944|ref|YP_008577781.1| ribosomal protein S11 (chloroplast) [Corymbia eximia] gi|545719030|ref|YP_008577866.1| ribosomal protein S11 (chloroplast) [Corymbia tessellaris] gi|545719116|ref|YP_008577951.1| ribosomal protein S11 (chloroplast) [Angophora floribunda] gi|545719202|ref|YP_008578036.1| ribosomal protein S11 (chloroplast) [Angophora costata] gi|442567132|gb|AGC57320.1| ribosomal protein S11 (chloroplast) [Eucalyptus patens] gi|442567304|gb|AGC57490.1| ribosomal protein S11 (chloroplast) [Eucalyptus curtisii] gi|442568508|gb|AGC58680.1| ribosomal protein S11 (chloroplast) [Eucalyptus salmonophloia] gi|442568594|gb|AGC58765.1| ribosomal protein S11 (chloroplast) [Eucalyptus microcorys] gi|442568680|gb|AGC58850.1| ribosomal protein S11 (chloroplast) [Eucalyptus guilfoylei] gi|442568766|gb|AGC58935.1| ribosomal protein S11 (chloroplast) [Eucalyptus erythrocorys] gi|442568938|gb|AGC59105.1| ribosomal protein S11 (chloroplast) [Corymbia maculata] gi|442569024|gb|AGC59190.1| ribosomal protein S11 (chloroplast) [Corymbia eximia] gi|442569110|gb|AGC59275.1| ribosomal protein S11 (chloroplast) [Corymbia tessellaris] gi|442569196|gb|AGC59360.1| ribosomal protein S11 (chloroplast) [Angophora floribunda] gi|442569282|gb|AGC59445.1| ribosomal protein S11 (chloroplast) [Angophora costata] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008575656.1| ribosomal protein S11 (chloroplast) [Eucalyptus sieberi] gi|545716880|ref|YP_008575741.1| ribosomal protein S11 (chloroplast) [Eucalyptus elata] gi|545716966|ref|YP_008575826.1| ribosomal protein S11 (chloroplast) [Eucalyptus regnans] gi|442566702|gb|AGC56895.1| ribosomal protein S11 (chloroplast) [Eucalyptus sieberi] gi|442566788|gb|AGC56980.1| ribosomal protein S11 (chloroplast) [Eucalyptus elata] gi|442566874|gb|AGC57065.1| ribosomal protein S11 (chloroplast) [Eucalyptus regnans] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008575486.1| ribosomal protein S11 (chloroplast) [Eucalyptus baxteri] gi|545716708|ref|YP_008575571.1| ribosomal protein S11 (chloroplast) [Eucalyptus diversifolia] gi|442566530|gb|AGC56725.1| ribosomal protein S11 (chloroplast) [Eucalyptus baxteri] gi|442566616|gb|AGC56810.1| ribosomal protein S11 (chloroplast) [Eucalyptus diversifolia] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_008575146.1| ribosomal protein S11 (chloroplast) [Eucalyptus obliqua] gi|545716364|ref|YP_008575231.1| ribosomal protein S11 (chloroplast) [Eucalyptus radiata] gi|545716450|ref|YP_008575316.1| ribosomal protein S11 (chloroplast) [Eucalyptus delegatensis] gi|545716536|ref|YP_008575401.1| ribosomal protein S11 (chloroplast) [Eucalyptus verrucata] gi|545717052|ref|YP_008575911.1| ribosomal protein S11 (chloroplast) [Eucalyptus umbra] gi|545717138|ref|YP_008575996.1| ribosomal protein S11 (chloroplast) [Eucalyptus cloeziana] gi|442566186|gb|AGC56385.1| ribosomal protein S11 (chloroplast) [Eucalyptus obliqua] gi|442566272|gb|AGC56470.1| ribosomal protein S11 (chloroplast) [Eucalyptus radiata] gi|442566358|gb|AGC56555.1| ribosomal protein S11 (chloroplast) [Eucalyptus delegatensis] gi|442566444|gb|AGC56640.1| ribosomal protein S11 (chloroplast) [Eucalyptus verrucata] gi|442566960|gb|AGC57150.1| ribosomal protein S11 (chloroplast) [Eucalyptus umbra] gi|442567046|gb|AGC57235.1| ribosomal protein S11 (chloroplast) [Eucalyptus cloeziana] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_007889894.1| ribosomal protein S11 [Francoa sonchifolia] gi|386268398|gb|AFJ00504.1| ribosomal protein S11 [Francoa sonchifolia] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >ref|YP_636332.1| ribosomal protein S11 [Eucalyptus globulus subsp. globulus] gi|309322479|ref|YP_003933993.1| ribosomal protein S11 [Eucalyptus grandis] gi|545717482|ref|YP_008576336.1| ribosomal protein S11 (chloroplast) [Eucalyptus melliodora] gi|545717568|ref|YP_008576421.1| ribosomal protein S11 (chloroplast) [Eucalyptus polybractea] gi|545717654|ref|YP_008576506.1| ribosomal protein S11 (chloroplast) [Eucalyptus cladocalyx] gi|545717740|ref|YP_008576591.1| ribosomal protein S11 (chloroplast) [Eucalyptus nitens] gi|545717826|ref|YP_008576676.1| ribosomal protein S11 (chloroplast) [Eucalyptus aromaphloia] gi|545717912|ref|YP_008576761.1| ribosomal protein S11 (chloroplast) [Eucalyptus saligna] gi|545717998|ref|YP_008576846.1| ribosomal protein S11 (chloroplast) [Eucalyptus camaldulensis] gi|545718084|ref|YP_008576931.1| ribosomal protein S11 (chloroplast) [Eucalyptus deglupta] gi|545718256|ref|YP_008577101.1| ribosomal protein S11 (chloroplast) [Eucalyptus torquata] gi|545718342|ref|YP_008577186.1| ribosomal protein S11 (chloroplast) [Eucalyptus diversicolor] gi|91207751|sp|Q49KW5.1|RR11_EUCGG RecName: Full=30S ribosomal protein S11, chloroplastic gi|60460840|gb|AAX21060.1| ribosomal protein S11 [Eucalyptus globulus subsp. globulus] gi|308223313|gb|ADO23621.1| ribosomal protein S11 [Eucalyptus grandis] gi|442567390|gb|AGC57575.1| ribosomal protein S11 (chloroplast) [Eucalyptus melliodora] gi|442567476|gb|AGC57660.1| ribosomal protein S11 (chloroplast) [Eucalyptus melliodora] gi|442567562|gb|AGC57745.1| ribosomal protein S11 (chloroplast) [Eucalyptus polybractea] gi|442567648|gb|AGC57830.1| ribosomal protein S11 (chloroplast) [Eucalyptus cladocalyx] gi|442567734|gb|AGC57915.1| ribosomal protein S11 (chloroplast) [Eucalyptus globulus] gi|442567820|gb|AGC58000.1| ribosomal protein S11 (chloroplast) [Eucalyptus nitens] gi|442567906|gb|AGC58085.1| ribosomal protein S11 (chloroplast) [Eucalyptus aromaphloia] gi|442567992|gb|AGC58170.1| ribosomal protein S11 (chloroplast) [Eucalyptus saligna] gi|442568078|gb|AGC58255.1| ribosomal protein S11 (chloroplast) [Eucalyptus camaldulensis] gi|442568164|gb|AGC58340.1| ribosomal protein S11 (chloroplast) [Eucalyptus deglupta] gi|442568336|gb|AGC58510.1| ribosomal protein S11 (chloroplast) [Eucalyptus torquata] gi|442568422|gb|AGC58595.1| ribosomal protein S11 (chloroplast) [Eucalyptus diversicolor] Length = 138 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 77 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 130 >gb|AFS35504.1| ribosomal protein S11, partial [Fragaria moschata] Length = 69 Score = 107 bits (268), Expect = 1e-21 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 416 GNSVRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 255 GN++RTVV+QGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC Sbjct: 11 GNAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGC 64