BLASTX nr result
ID: Achyranthes22_contig00044182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00044182 (437 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302687.2| hypothetical protein POPTR_0002s18350g [Popu... 55 7e-06 ref|XP_002515123.1| Auxin-induced protein 5NG4, putative [Ricinu... 55 1e-05 >ref|XP_002302687.2| hypothetical protein POPTR_0002s18350g [Populus trichocarpa] gi|550345299|gb|EEE81960.2| hypothetical protein POPTR_0002s18350g [Populus trichocarpa] Length = 364 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +3 Query: 3 EQIYLGSVIGSILVISGLYILLWGKSCEASSSFTKPAEI 119 EQIYLGSV+GS+LVI GLYILLWGKS EA K A + Sbjct: 304 EQIYLGSVLGSVLVILGLYILLWGKSIEAGDCGEKQAHL 342 >ref|XP_002515123.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223545603|gb|EEF47107.1| Auxin-induced protein 5NG4, putative [Ricinus communis] Length = 402 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +3 Query: 3 EQIYLGSVIGSILVISGLYILLWGKSCEASSSFTKPAEIV 122 +QIYLGSVIGSILVI+GLY LLWGKS EA K +V Sbjct: 340 DQIYLGSVIGSILVIAGLYTLLWGKSIEAEECAMKQKSVV 379