BLASTX nr result
ID: Achyranthes22_contig00044103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00044103 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064010.1| orf103b gene product (mitochondrion) [Beta vulg... 65 1e-08 >ref|NP_064010.1| orf103b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435145|ref|YP_004222363.1| hypothetical protein BevumaM_p130 [Beta vulgaris subsp. maritima] gi|346683236|ref|YP_004842168.1| hypothetical protein BemaM_p124 [Beta macrocarpa] gi|9049312|dbj|BAA99322.1| orf103b [Beta vulgaris subsp. vulgaris] gi|317905595|emb|CBJ14003.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439878|emb|CBJ17579.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148032|emb|CBJ20696.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500154|emb|CBX24973.1| hypothetical protein [Beta macrocarpa] gi|384977920|emb|CBL54144.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 103 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 69 RKCLLTKRVVFKASELVELRAGTSRKDCWRIDLRARG 179 ++ TKRVVFKASELVELRAGTSRK+CW+IDLRARG Sbjct: 67 KRLRFTKRVVFKASELVELRAGTSRKECWQIDLRARG 103