BLASTX nr result
ID: Achyranthes22_contig00044090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00044090 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 6e-09 ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 6e-09 ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 6e-09 ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [A... 65 7e-09 ref|XP_002314452.2| mitochondrial substrate carrier family prote... 65 9e-09 gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus pe... 65 9e-09 gb|EOY06485.1| Mitochondrial substrate carrier family protein [T... 65 1e-08 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 65 1e-08 gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Mor... 64 2e-08 ref|NP_199708.1| mitochondrial substrate carrier family protein ... 64 2e-08 ref|XP_006395106.1| hypothetical protein EUTSA_v10004544mg [Eutr... 64 2e-08 ref|XP_006280770.1| hypothetical protein CARUB_v10026741mg [Caps... 64 2e-08 ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosph... 64 2e-08 ref|XP_002865695.1| mitochondrial substrate carrier family prote... 64 2e-08 gb|ABK25070.1| unknown [Picea sitchensis] 64 2e-08 ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citr... 64 2e-08 ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putat... 64 3e-08 ref|XP_006389228.1| mitochondrial substrate carrier family prote... 63 4e-08 >ref|XP_006349808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 329 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPSIVKAAPAGAVTFVAYE+ SDWL+S L Sbjct: 294 GLYKGIVPSIVKAAPAGAVTFVAYEYTSDWLESIL 328 >ref|XP_006342787.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum tuberosum] Length = 331 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS++KAAPAGAVTFVAYE+ SDWL+S L Sbjct: 296 GLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKL 330 >ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Solanum lycopersicum] Length = 331 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS++KAAPAGAVTFVAYE+ SDWL+S L Sbjct: 296 GLYKGIVPSVIKAAPAGAVTFVAYEYTSDWLESKL 330 >ref|XP_006855518.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] gi|548859284|gb|ERN16985.1| hypothetical protein AMTR_s00057p00207420 [Amborella trichopoda] Length = 369 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPSI+KAAPAGAVTFVAYE+ SDWL+S L Sbjct: 334 GLYKGIVPSIIKAAPAGAVTFVAYEYTSDWLESIL 368 >ref|XP_002314452.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550328947|gb|EEF00623.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 341 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYEF SDWL+S L Sbjct: 306 GLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLESIL 340 >gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica] Length = 331 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYE+ SDWL+S+L Sbjct: 296 GLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESAL 330 >gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS +KAAPAGAVTFVAYEF SDWL+S L Sbjct: 295 GLYKGIVPSTIKAAPAGAVTFVAYEFTSDWLESIL 329 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPSI+K+APAGAVTFVAYEF SDWL+S Sbjct: 295 GLYKGIVPSIIKSAPAGAVTFVAYEFTSDWLES 327 >gb|EXB74801.1| Mitochondrial thiamine pyrophosphate carrier [Morus notabilis] Length = 331 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTFVAYE++SDWL+S Sbjct: 296 GLYKGIVPSTVKAAPAGAVTFVAYEYISDWLES 328 >ref|NP_199708.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] gi|10177187|dbj|BAB10321.1| mitochondrial carrier protein-like [Arabidopsis thaliana] gi|26449838|dbj|BAC42042.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|30017309|gb|AAP12888.1| At5g48970 [Arabidopsis thaliana] gi|332008368|gb|AED95751.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] Length = 339 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTFVAYEF SDWL+S Sbjct: 304 GLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLES 336 >ref|XP_006395106.1| hypothetical protein EUTSA_v10004544mg [Eutrema salsugineum] gi|557091745|gb|ESQ32392.1| hypothetical protein EUTSA_v10004544mg [Eutrema salsugineum] Length = 337 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTFVAYEF SDWL+S Sbjct: 302 GLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLES 334 >ref|XP_006280770.1| hypothetical protein CARUB_v10026741mg [Capsella rubella] gi|482549474|gb|EOA13668.1| hypothetical protein CARUB_v10026741mg [Capsella rubella] Length = 338 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTFVAYEF SDWL+S Sbjct: 303 GLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLES 335 >ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Fragaria vesca subsp. vesca] Length = 330 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYE+ SDWL+S L Sbjct: 296 GLYKGIVPSTVKAAPAGAVTFVAYEYTSDWLESRL 330 >ref|XP_002865695.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297311530|gb|EFH41954.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 338 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTFVAYEF SDWL+S Sbjct: 303 GLYKGIVPSTVKAAPAGAVTFVAYEFTSDWLES 335 >gb|ABK25070.1| unknown [Picea sitchensis] Length = 329 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS++KAAPAGAVTFV YE+ SDWLDS Sbjct: 294 GLYKGIVPSVIKAAPAGAVTFVVYEYTSDWLDS 326 >ref|XP_006419608.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521481|gb|ESR32848.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 268 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYE+ SDWL+S L Sbjct: 233 GLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESIL 267 >ref|XP_006419607.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|568871878|ref|XP_006489106.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Citrus sinensis] gi|557521480|gb|ESR32847.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 333 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYE+ SDWL+S L Sbjct: 298 GLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESIL 332 >ref|XP_006419605.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] gi|557521478|gb|ESR32845.1| hypothetical protein CICLE_v10005390mg [Citrus clementina] Length = 241 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGIVPS VKAAPAGAVTFVAYE+ SDWL+S L Sbjct: 206 GLYKGIVPSTVKAAPAGAVTFVAYEYASDWLESIL 240 >ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 331 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDSSL 351 GLYKGI+PS +KAAPAGAVTFVAYEF SDWL+S L Sbjct: 296 GLYKGILPSTIKAAPAGAVTFVAYEFTSDWLESIL 330 >ref|XP_006389228.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550311967|gb|ERP48142.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 455 GLYKGIVPSIVKAAPAGAVTFVAYEFLSDWLDS 357 GLYKGIVPS VKAAPAGAVTF+AYEF SDWL+S Sbjct: 307 GLYKGIVPSTVKAAPAGAVTFLAYEFTSDWLES 339