BLASTX nr result
ID: Achyranthes22_contig00043647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00043647 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437785.1| hypothetical protein CICLE_v10033580mg [Citr... 59 9e-07 ref|XP_002514530.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_006437785.1| hypothetical protein CICLE_v10033580mg [Citrus clementina] gi|557539981|gb|ESR51025.1| hypothetical protein CICLE_v10033580mg [Citrus clementina] Length = 495 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/79 (46%), Positives = 47/79 (59%), Gaps = 6/79 (7%) Frame = -2 Query: 221 FFNNLIYTNSKQRFSS*ETMKDRGKREVEAYNNNG------DYLGDNIPEFRCKKHPASS 60 FF + + +S + +S MKDRGK VE YNN+G DY + + CKKHP SS Sbjct: 68 FFFSFLSFSSSYKLNSVAAMKDRGKA-VEVYNNSGGNEFFQDYSCSS--DLPCKKHPQSS 124 Query: 59 SSTGGICAYCLTDKLAELV 3 S GICAYCL D+L +LV Sbjct: 125 SV--GICAYCLKDRLVKLV 141 >ref|XP_002514530.1| conserved hypothetical protein [Ricinus communis] gi|223546134|gb|EEF47636.1| conserved hypothetical protein [Ricinus communis] Length = 408 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = -2 Query: 164 MKDRGKREVEAYNNNGDYLGDNIPEFRCKKHPASSSSTGGICAYCLTDKLAELV 3 MK+RGK VE +N++ +Y + + CKKHP+SSS GICAYCL D+L +LV Sbjct: 1 MKERGKA-VEVFNDDQEYYTSSYYDLPCKKHPSSSSV--GICAYCLKDRLVKLV 51