BLASTX nr result
ID: Achyranthes22_contig00043452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00043452 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54617.1| hypothetical protein L484_019189 [Morus notabilis] 61 1e-07 gb|ABK28042.1| unknown [Arabidopsis thaliana] 55 8e-06 ref|NP_001118615.1| uncharacterized protein [Arabidopsis thalian... 55 8e-06 ref|XP_002884853.1| hypothetical protein ARALYDRAFT_897362 [Arab... 55 1e-05 >gb|EXB54617.1| hypothetical protein L484_019189 [Morus notabilis] Length = 62 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 197 SVGAYLSFLNIEPQQARVKARTDFIKQRLRKFLDD 93 +VGAY+SF NIEPQQARVKAR DF+K+RLRK LDD Sbjct: 28 AVGAYMSFSNIEPQQARVKARRDFVKERLRKLLDD 62 >gb|ABK28042.1| unknown [Arabidopsis thaliana] Length = 64 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 191 GAYLSFLNIEPQQARVKARTDFIKQRLRKFLDD 93 GAYLS NI PQQARVKAR DF+K R+RK+LDD Sbjct: 31 GAYLSLANISPQQARVKARNDFVKDRIRKWLDD 63 >ref|NP_001118615.1| uncharacterized protein [Arabidopsis thaliana] gi|98962067|gb|ABF59363.1| unknown protein [Arabidopsis thaliana] gi|332641550|gb|AEE75071.1| uncharacterized protein AT3G11591 [Arabidopsis thaliana] Length = 63 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 191 GAYLSFLNIEPQQARVKARTDFIKQRLRKFLDD 93 GAYLS NI PQQARVKAR DF+K R+RK+LDD Sbjct: 31 GAYLSLANISPQQARVKARNDFVKDRIRKWLDD 63 >ref|XP_002884853.1| hypothetical protein ARALYDRAFT_897362 [Arabidopsis lyrata subsp. lyrata] gi|297330693|gb|EFH61112.1| hypothetical protein ARALYDRAFT_897362 [Arabidopsis lyrata subsp. lyrata] Length = 63 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 191 GAYLSFLNIEPQQARVKARTDFIKQRLRKFLDD 93 GAYLS NI PQQARVKAR DF+K R+RK+LDD Sbjct: 31 GAYLSLANIAPQQARVKARNDFVKDRIRKWLDD 63