BLASTX nr result
ID: Achyranthes22_contig00043315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00043315 (515 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006397341.1| hypothetical protein EUTSA_v10029205mg [Eutr... 92 9e-17 gb|ESW04925.1| hypothetical protein PHAVU_011G1370001g, partial ... 73 4e-11 ref|XP_002324217.2| hypothetical protein POPTR_0018s08080g [Popu... 51 5e-11 ref|XP_002535138.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 >ref|XP_006397341.1| hypothetical protein EUTSA_v10029205mg [Eutrema salsugineum] gi|557098358|gb|ESQ38794.1| hypothetical protein EUTSA_v10029205mg [Eutrema salsugineum] Length = 78 Score = 91.7 bits (226), Expect = 9e-17 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 160 EKVAYLKERAGTLVF*PHYTMNSCGALCTYNFYEKQVNGASAWRTERFIKPFLA 321 +KVA+LKER GTLVF HY + SCGALCTY Y+KQVNGA AWRTERFIKPFLA Sbjct: 22 KKVAHLKERVGTLVFQHHYAIYSCGALCTYRLYDKQVNGAGAWRTERFIKPFLA 75 >gb|ESW04925.1| hypothetical protein PHAVU_011G1370001g, partial [Phaseolus vulgaris] Length = 85 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = +1 Query: 175 LKERAGTLVF*PHY--TMNSCGALCTYNFYEKQVNGASAWRTERFI 306 +KERA TLVF PHY T++SC ALCTY+ Y+KQVNGA AWRTERFI Sbjct: 23 MKERASTLVFQPHYHYTIHSCRALCTYSLYDKQVNGAGAWRTERFI 68 >ref|XP_002324217.2| hypothetical protein POPTR_0018s08080g [Populus trichocarpa] gi|550318305|gb|EEF02782.2| hypothetical protein POPTR_0018s08080g [Populus trichocarpa] Length = 83 Score = 51.2 bits (121), Expect(2) = 5e-11 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = +1 Query: 238 LCTYNFYEKQVNGASAWRTERFIKPFL 318 +CTY+ Y+KQVNG SAWRT++FIKPFL Sbjct: 44 VCTYSLYDKQVNGVSAWRTKQFIKPFL 70 Score = 41.6 bits (96), Expect(2) = 5e-11 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = +2 Query: 161 KKWPT*KKGRALLCFNLTIL*IVV 232 KKWPT KKGRAL CFN TIL IVV Sbjct: 20 KKWPTRKKGRALSCFNSTILLIVV 43 >ref|XP_002535138.1| conserved hypothetical protein [Ricinus communis] gi|223523943|gb|EEF27244.1| conserved hypothetical protein [Ricinus communis] Length = 57 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/66 (56%), Positives = 41/66 (62%) Frame = +1 Query: 124 IYAVTVIPNCILEKVAYLKERAGTLVF*PHYTMNSCGALCTYNFYEKQVNGASAWRTERF 303 IY V VIP+C+ EKVAYLK RA +L Y+KQVNGA AWRTERF Sbjct: 8 IYTVMVIPDCVPEKVAYLKGRALSL-------------------YDKQVNGAGAWRTERF 48 Query: 304 IKPFLA 321 IKPFLA Sbjct: 49 IKPFLA 54