BLASTX nr result
ID: Achyranthes22_contig00042774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00042774 (317 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596625.1| F-box/LRR-repeat protein [Medicago truncatul... 56 4e-06 ref|XP_004305029.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g... 55 7e-06 gb|EMJ13826.1| hypothetical protein PRUPE_ppa016126mg [Prunus pe... 55 1e-05 >ref|XP_003596625.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355485673|gb|AES66876.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 411 Score = 56.2 bits (134), Expect = 4e-06 Identities = 36/80 (45%), Positives = 47/80 (58%), Gaps = 6/80 (7%) Frame = -2 Query: 307 ISNLPDIVLADILSLLPTKDA---GLLSMRWMYIHTWITRLDFH---HDPPILPTFPSFK 146 ISNLPD ++ +LS LPTKDA +LS RW+Y+ T+IT+LDF + F Sbjct: 29 ISNLPDHIIGCVLSFLPTKDAVSTSVLSKRWIYLWTFITKLDFDDIGYCSSNEIRKACFV 88 Query: 145 IFVDKVLQNCQSEIISTFKL 86 FVD+VL SE I +F L Sbjct: 89 DFVDRVLLRLNSEHIRSFSL 108 >ref|XP_004305029.1| PREDICTED: F-box/FBD/LRR-repeat protein At5g53840-like [Fragaria vesca subsp. vesca] Length = 572 Score = 55.5 bits (132), Expect = 7e-06 Identities = 34/82 (41%), Positives = 49/82 (59%), Gaps = 4/82 (4%) Frame = -2 Query: 316 IGRISNLPDIVLADILSLLPTKDA---GLLSMRWMYIHTWITRLDFHHDPPILPTFPSFK 146 + RIS LPD ++ I+SLLP K+A +LS RW +I T++T LDFHHD IL S+K Sbjct: 106 VDRISALPDDLIVSIVSLLPLKEATATSVLSTRWRHIWTFVTTLDFHHD--ILFQLRSYK 163 Query: 145 -IFVDKVLQNCQSEIISTFKLH 83 + ++ L + + S K H Sbjct: 164 RVRIESELDRYLNWVNSVMKQH 185 >gb|EMJ13826.1| hypothetical protein PRUPE_ppa016126mg [Prunus persica] Length = 352 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/80 (46%), Positives = 44/80 (55%), Gaps = 4/80 (5%) Frame = -2 Query: 310 RISNLPDIVLADILSLLPTKDA---GLLSMRWMYIHTWITRLDFHHD-PPILPTFPSFKI 143 RIS LPD VL ILS LPTK A +LS RW I + LDF + P + SF + Sbjct: 23 RISELPDAVLCHILSFLPTKLAVRTSILSTRWKNIWASVHNLDFDDEYDPWIERDDSFSM 82 Query: 142 FVDKVLQNCQSEIISTFKLH 83 FVD+VL S I F+LH Sbjct: 83 FVDRVLSFRGSADIHKFRLH 102